KEGG   Homo sapiens (human): 442425Help
Entry
442425            CDS       T01001                                 

Gene name
FOXB2, bA159H20.4
Definition
(RefSeq) forkhead box B2
  KO
K09395  forkhead box protein B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    442425 (FOXB2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    442425 (FOXB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 442425
NCBI-ProteinID: NP_001013757
HGNC: 23315
Ensembl: ENSG00000204612
Vega: OTTHUMG00000020051
Pharos: Q5VYV0(Tdark)
UniProt: Q5VYV0
Position
9q21.2
AA seq 432 aa AA seqDB search
MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHTHLH
AGSTKSAPGAGPGGHLHPHHHHHPHHHHHHHAAAHHHHHHHPPQPPPPPPPPPPHMVHYF
HQQPPTAPQPPPHLPSQPPQQPPQQSQPQQPSHPGKMQEAAAVAAAAAAAAAAAVGSVGR
LSQFPPYGLGSAAAAAAAAAASTSGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGY
PVPGQLGNVVSSVWPHVGVMDSVAAAAAAAAAAGVPVGPEYGAFGVPVKSLCHSASQSLP
AMPVPIKPTPALPPVSALQPGLTVPAASQQPPAPSTVCSAAAASPVASLLEPTAPTSAES
KGGSLHSVLVHS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggccggggaagagctcgtacagcgaccaaaaaccgccctactcttacatctcg
ctgaccgccatggcaatccagcactcggccgagaagatgctgccgctgagcgacatctac
aagttcatcatggagcgcttcccctactaccgcgagcacacacagcgctggcagaacagc
ctgcgccacaacctctccttcaacgactgcttcatcaagattccgcggaggcccgaccag
cctggcaagggtagcttctgggcgctgcaccccgactgcggggacatgttcgagaacggc
agcttcctgcggcgtcgcaagcgcttcaaggtgctgcgcgccgaccatactcacttgcac
gcgggaagcaccaagagcgcgccgggcgccggtccgggagggcaccttcacccccatcac
caccaccacccccaccaccaccatcatcaccacgctgccgcacaccaccaccatcaccac
cacccaccccagccgccgccgccgccgcccccgccgccgccgcacatggtacactatttc
catcagcaaccgcctactgctccgcagccgcctccgcacctcccgtcacagcccccgcag
caaccgccccagcagtcgcagcctcagcagccgtctcaccccggcaagatgcaggaggcg
gcggccgtggcggcggcggcggcggcggccgcggcagccgcggtgggcagcgtgggacgc
ctgtctcagttcccaccctacgggctgggctcggccgccgccgctgccgccgcggccgcg
gcgtccacgtcaggcttcaagcacccctttgccattgagaacattattggccgggactac
aagggcgtgctgcaggctggagggctgcccttggcgtccgtcatgcaccacctgggctac
cccgtgcccggccagcttggcaacgtcgtcagctccgtgtggccgcacgttggcgtcatg
gattcggtggccgccgccgcggccgccgcagccgcagccggagtccctgtaggcccggag
tatggggccttcggggtcccggtcaagtccctgtgccactcggcaagccagagcctgcct
gccatgccggtgcccatcaagcccacgcctgcgctgccgcccgtgtccgcgctgcagccg
gggctcactgtccccgcggcttcgcagcagcctccggcgccatccaccgtgtgctccgcg
gccgcggcctcgcccgttgcctctctgctggagcccacagcccctacctcggccgaaagc
aagggcggctccttgcactcggtgctagtgcactcctag

DBGET integrated database retrieval system