KEGG   Homo sapiens (human): 443
Entry
443               CDS       T01001                                 
Symbol
ASPA, ACY2, ASP
Name
(RefSeq) aspartoacylase
  KO
K01437  aspartoacylase [EC:3.5.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00340  Histidine metabolism
hsa01100  Metabolic pathways
Disease
H00074  Canavan disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    443 (ASPA)
   00340 Histidine metabolism
    443 (ASPA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.15  aspartoacylase
     443 (ASPA)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 443
NCBI-ProteinID: NP_000040
OMIM: 608034
HGNC: 756
Ensembl: ENSG00000108381
Pharos: P45381(Tbio)
UniProt: P45381 Q6FH48
Structure
Position
17:3474110..3503405
AA seq 313 aa
MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK
CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG
PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA
AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK
LTLNAKSIRCCLH
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacttcttgtcacattgctgaagaacatatacaaaaggttgctatctttggaggaacc
catgggaatgagctaaccggagtatttctggttaagcattggctagagaatggcgctgag
attcagagaacagggctggaggtaaaaccatttattactaaccccagagcagtgaagaag
tgtaccagatatattgactgtgacctgaatcgcatttttgaccttgaaaatcttggcaaa
aaaatgtcagaagatttgccatatgaagtgagaagggctcaagaaataaatcatttattt
ggtccaaaagacagtgaagattcctatgacattatttttgaccttcacaacaccacctct
aacatggggtgcactcttattcttgaggattccaggaataactttttaattcagatgttt
cattacattaagacttctctggctccactaccctgctacgtttatctgattgagcatcct
tccctcaaatatgcgaccactcgttccatagccaagtatcctgtgggtatagaagttggt
cctcagcctcaaggggttctgagagctgatatcttggatcaaatgagaaaaatgattaaa
catgctcttgattttatacatcatttcaatgaaggaaaagaatttcctccctgcgccatt
gaggtctataaaattatagagaaagttgattacccccgggatgaaaatggagaaattgct
gctatcatccatcctaatctgcaggatcaagactggaaaccactgcatcctggggatccc
atgtttttaactcttgatgggaagacgatcccactgggcggagactgtaccgtgtacccc
gtgtttgtgaatgaggccgcatattacgaaaagaaagaagcttttgcaaagacaactaaa
ctaacgctcaatgcaaaaagtattcgctgctgtttacattag

DBGET integrated database retrieval system