KEGG   Homo sapiens (human): 4435
Entry
4435              CDS       T01001                                 
Symbol
CITED1, MSG1
Name
(RefSeq) Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1
  KO
K22527  Cbp/p300-interacting transactivator 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    4435 (CITED1)
SSDB
Motif
Pfam: CITED
Other DBs
NCBI-GeneID: 4435
NCBI-ProteinID: NP_001138358
OMIM: 300149
HGNC: 1986
Ensembl: ENSG00000125931
Pharos: Q99966(Tbio)
UniProt: Q99966
Position
X:complement(72301646..72307157)
AA seq 193 aa
MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGA
PTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGP
LQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQ
NEFDFTADFPSSC
NT seq 582 nt   +upstreamnt  +downstreamnt
atgccaacaacgtcgaggcctgcacttgatgtcaagggtggcacctcacctgcgaaggag
gatgccaaccaagagatgagctccgtggcctactccaaccttgcggtgaaagatcgcaaa
gcagtggccattctgcactaccctggggtagcctcaaatggaaccaaggccagtggggct
cccactagttcctcgggatctccaataggctctcctacaaccacccctcccactaaaccc
ccatccttcaacctgcaccccgcccctcacttgctggctagtatgcacctgcagaaactt
aatagccagtatcaggggatggctgctgccactccaggccaacccggggaggcaggaccc
ctgcaaaactgggactttggggcccaggcgggaggggcagaatcactctctccttctgct
ggtgcccagagccctgctatcatcgattcggacccagtggatgaggaagtgctgatgtcg
ctggtggtggaactggggttggaccgagccaatgagcttccggagctgtggctggggcag
aatgagtttgacttcactgcggactttccatctagctgctaa

DBGET integrated database retrieval system