KEGG   Homo sapiens (human): 4437Help
Entry
4437              CDS       T01001                                 

Gene name
MSH3, DUP, FAP4, MRP1
Definition
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03430  Mismatch repair
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4437 (MSH3)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    4437 (MSH3)
   05210 Colorectal cancer
    4437 (MSH3)
  09168 Drug resistance
   01524 Platinum drug resistance
    4437 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4437 (MSH3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     4437 (MSH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV
Motif
Other DBs
NCBI-GeneID: 4437
NCBI-ProteinID: NP_002430
OMIM: 600887
HGNC: 7326
Ensembl: ENSG00000113318
Vega: OTTHUMG00000162540
Pharos: P20585(Tbio)
UniProt: P20585
Structure
PDB: 

Position
5q14.1
AA seq 1137 aa AA seqDB search
MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAA
AAPPAPPAPAFPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSE
PKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNA
VSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRSKSIYTPLELQYIEMK
QQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAK
GYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKLDDAVNVDEIM
TDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDT
VDIKGSQIISGIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGT
TLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEV
LHSESSVFGQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQAIIPAVN
SHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKTELFKDLSDFPLIKKRKDEIQ
GVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSRF
HSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMG
GKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTA
EIIRKATSQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKN
YSHQVGNYHMGFLVSEDESKLDPGAAEQVPDFVTFLYQITRGIAARSYGLNVAKLADVPG
EILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQKWTEEFNMEETQTSLLH
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccggaagcctgcgtcgggcggcctcgctgcctccagctcagcccctgcgagg
caagcggttttgagccgattcttccagtctacgggaagcctgaaatccacctcctcctcc
acaggtgcagccgaccaggtggaccctggcgctgcagcggctgcagcggccgcagcggcc
gcagcgcccccagcgcccccagctcccgccttcccgccccagctgccgccgcacatagct
acagaaattgacagaagaaagaagagaccattggaaaatgatgggcctgttaaaaagaaa
gtaaagaaagtccaacaaaaggaaggaggaagtgatctgggaatgtctggcaactctgag
ccaaagaaatgtctgaggaccaggaatgtttcaaagtctctggaaaaattgaaagaattc
tgctgcgattctgcccttcctcaaagtagagtccagacagaatctctgcaggagagattt
gcagttctgccaaaatgtactgattttgatgatatcagtcttctacacgcaaagaatgca
gtttcttctgaagattcgaaacgtcaaattaatcaaaaggacacaacactttttgatctc
agtcagtttggatcatcaaatacaagtcatgaaaatttacagaaaactgcttccaaatca
gctaacaaacggtccaaaagcatctatacgccgctagaattacaatacatagaaatgaag
cagcagcacaaagatgcagttttgtgtgtggaatgtggatataagtatagattctttggg
gaagatgcagagattgcagcccgagagctcaatatttattgccatttagatcacaacttt
atgacagcaagtatacctactcacagactgtttgttcatgtacgccgcctggtggcaaaa
ggatataaggtgggagttgtgaagcaaactgaaactgcagcattaaaggccattggagac
aacagaagttcactcttttcccggaaattgactgccctttatacaaaatctacacttatt
ggagaagatgtgaatcccctaatcaagctggatgatgctgtaaatgttgatgagataatg
actgatacttctaccagctatcttctgtgcatctctgaaaataaggaaaatgttagggac
aaaaaaaagggcaacatttttattggcattgtgggagtgcagcctgccacaggcgaggtt
gtgtttgatagtttccaggactctgcttctcgttcagagctagaaacccggatgtcaagc
ctgcagccagtagagctgctgcttccttcggccttgtccgagcaaacagaggcgctcatc
cacagagccacatctgttagtgtgcaggatgacagaattcgagtcgaaaggatggataac
atttattttgaatacagccatgctttccaggcagttacagagttttatgcaaaagataca
gttgacatcaaaggttctcaaattatttctggcattgttaacttagagaagcctgtgatt
tgctctttggctgccatcataaaatacctcaaagaattcaacttggaaaagatgctctcc
aaacctgagaattttaaacagctatcaagtaaaatggaatttatgacaattaatggaaca
acattaaggaatctggaaatcctacagaatcagactgatatgaaaaccaaaggaagtttg
ctgtgggttttagaccacactaaaacttcatttgggagacggaagttaaagaagtgggtg
acccagccactccttaaattaagggaaataaatgcccggcttgatgctgtatcggaagtt
ctccattcagaatctagtgtgtttggtcagatagaaaatcatctacgtaaattgcccgac
atagagaggggactctgtagcatttatcacaaaaaatgttctacccaagagttcttcttg
attgtcaaaactttatatcacctaaagtcagaatttcaagcaataatacctgctgttaat
tcccacattcagtcagacttgctccggaccgttattttagaaattcctgaactcctcagt
ccagtggagcattacttaaagatactcaatgaacaagctgccaaagttggggataaaact
gaattatttaaagacctttctgacttccctttaataaaaaagaggaaggatgaaattcaa
ggtgttattgacgagatccgaatgcatttgcaagaaatacgaaaaatactaaaaaatcct
tctgcacaatatgtgacagtatcaggacaggagtttatgatagaaataaagaactctgct
gtatcttgtataccaactgattgggtaaaggttggaagcacaaaagctgtgagccgcttt
cactctccttttattgtagaaaattacagacatctgaatcagctccgggagcagctagtc
cttgactgcagtgctgaatggcttgattttctagagaaattcagtgaacattatcactcc
ttgtgtaaagcagtgcatcacctagcaactgttgactgcattttctccctggccaaggtc
gctaagcaaggagattactgcagaccaactgtacaagaagaaagaaaaattgtaataaaa
aatggaaggcaccctgtgattgatgtgttgctgggagaacaggatcaatatgtcccaaat
aatacagatttatcagaggactcagagagagtaatgataattaccggaccaaacatgggt
ggaaagagctcctacataaaacaagttgcattgattaccatcatggctcagattggctcc
tatgttcctgcagaagaagcgacaattgggattgtggatggcattttcacaaggatgggt
gctgcagacaatatatataaaggacagagtacatttatggaagaactgactgacacagca
gaaataatcagaaaagcaacatcacagtccttggttatcttggatgaactaggaagaggg
acgagcactcatgatggaattgccattgcctatgctacacttgagtatttcatcagagat
gtgaaatccttaaccctgtttgtcacccattatccgccagtttgtgaactagaaaaaaat
tactcacaccaggtggggaattaccacatgggattcttggtcagtgaggatgaaagcaaa
ctggatccaggcgcagcagaacaagtccctgattttgtcaccttcctttaccaaataact
agaggaattgcagcaaggagttatggattaaatgtggctaaactagcagatgttcctgga
gaaattttgaagaaagcagctcacaagtcaaaagagctggaaggattaataaatacgaaa
agaaagagactcaagtattttgcaaagttatggacgatgcataatgcacaagacctgcag
aagtggacagaggagttcaacatggaagaaacacagacttctcttcttcattaa

DBGET integrated database retrieval system