KEGG   Homo sapiens (human): 4439Help
Entry
4439              CDS       T01001                                 

Gene name
MSH5, G7, MUTSH5, NG23, POF13
Definition
(RefSeq) mutS homolog 5
  KO
K08741  DNA mismatch repair protein MSH5
Organism
hsa  Homo sapiens (human)
Disease
H00627  Premature ovarian failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4439 (MSH5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutS homologs specialized for meiosis
     4439 (MSH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_IV
Motif
Other DBs
NCBI-GeneID: 4439
NCBI-ProteinID: NP_002432
OMIM: 603382
HGNC: 7328
Ensembl: ENSG00000204410
Vega: OTTHUMG00000167551
Pharos: O43196(Tbio)
UniProt: O43196 A0A024RCM1
Position
6p21.33
AA seq 834 aa AA seqDB search
MASLGANPRRTPQGPRPGAASSGFPSPAPVPGPREAEEEEVEEEEELAEIHLCVLWNSGY
LGIAYYDTSDSTIHFMPDAPDHESLKLLQRVLDEINPQSVVTSAKQDENMTRFLGKLASQ
EHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTV
RALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPS
VYKVASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNL
DMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLF
RDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEV
ARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRS
ARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAAR
DYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSI
YLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVN
NATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQ
GPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRS
GKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttaggagcgaacccaaggaggacaccgcagggaccgagacctggggcggcc
tcctccggcttccccagcccggccccagtgccgggccccagggaggccgaggaggaggaa
gtcgaggaggaggaggagctggccgagatccatctgtgtgtgctgtggaattcaggatac
ttgggcattgcctactatgatactagtgactccactatccacttcatgccagatgcccca
gaccacgagagcctcaagcttctccagagagttctggatgagatcaatccccagtctgtt
gttacgagtgccaaacaggatgagaatatgactcgatttctgggaaagcttgcctcccag
gagcacagagagcctaaaagacctgaaatcatatttttgccaagtgtggattttggtctg
gagataagcaaacaacgcctcctttctggaaactactccttcatcccagacgccatgact
gccactgagaaaatcctcttcctctcttccattattccctttgactgcctcctcacagtt
cgagcacttggagggctgctgaagttcctgggtcgaagaagaatcggggttgaactggaa
gactataatgtcagcgtccccatcctgggctttaagaaatttatgttgactcatctggtg
aacatagatcaagacacttacagtgttctacagatttttaagagtgagtctcacccctca
gtgtacaaagtggccagtggactgaaggaggggctcagcctctttggaatcctcaacaga
tgccactgtaagtggggagagaagctgctcaggctatggttcacacgtccgactcatgac
ctgggggagctcagttctcgtctggacgtcattcagttttttctgctgccccagaatctg
gacatggctcagatgctgcatcggctcctgggtcacatcaagaacgtgcctctgattctg
aaacgcatgaagttgtcccacaccaaggtcagcgactggcaggttctctacaagactgtg
tacagtgccctgggcctgagggatgcctgccgctccctgccgcagtccatccagctcttt
cgggacattgcccaagagttctctgatgacctgcaccatatcgccagcctcattgggaaa
gtagtggactttgagggcagccttgctgaaaatcgcttcacagtcctccccaacatagat
cctgaaattgatgagaaaaagcgaagactgatgggacttcccagtttccttactgaggtt
gcccgcaaggagctggagaatctggactcccgtattccttcatgcagtgtcatctacatc
cctctgattggcttccttctttctattccccgcctgccttccatggtagaggccagtgac
tttgagattaatggactggacttcatgtttctctcagaggagaagctgcactatcgtagt
gcccgaaccaaggagctggatgcattgctgggggacctgcactgcgagatccgggaccag
gagacgctgctgatgtaccagctacagtgccaggtgctggcacgagcagctgtcttaacc
cgagtattggaccttgcctcccgcctggacgtcctgctggctcttgccagtgctgcccgg
gactatggctactcaaggccgcgttactccccacaagtccttggggtacgaatccagaat
ggcagacatcctctgatggaactctgtgcccgaacctttgtgcccaactccacagaatgt
ggtggggacaaagggagggtcaaagtcatcactggacccaactcatcagggaagagcata
tacctcaaacaggtaggcttgatcacattcatggccctggtaggcagctttgtgccagca
gaggaggccgaaattggggcagtagacgccatcttcacacgaattcatagctgcgaatcc
atctcccttggcctctccaccttcatgatcgacctcaaccaggtggcgaaagcagtgaac
aatgccactgcacagtcgctggtccttattgatgaatttggaaagggaaccaacacggtg
gatgggctcgcgcttctggccgctgtgctccgacactggctggcacgtggacccacatgc
ccccacatctttgtggccaccaactttctgagccttgttcagctacaactgctgccacaa
gggcccctggtgcagtatttgaccatggagacctgtgaggatggcaacgatcttgtcttc
ttctatcaggtttgcgaaggtgttgcgaaggccagccatgcctcccacacagctgcccag
gctgggcttcctgacaagcttgtggctcgtggcaaggaggtctcagacttgatccgcagt
ggaaaacccatcaagcctgtcaaggatttgctaaagaagaaccaaatggaaaattgccag
acattagtggataagtttatgaaactggatttggaagatcctaacctggacttgaacgtt
ttcatgagccaggaagtgctgcctgctgccaccagcatcctctga

DBGET integrated database retrieval system