KEGG   Homo sapiens (human): 4440
Entry
4440              CDS       T01001                                 

Gene name
MSI1
Definition
(RefSeq) musashi RNA binding protein 1
  KO
K14411  RNA-binding protein Musashi
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4440 (MSI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4440 (MSI1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4440 (MSI1)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 4440
NCBI-ProteinID: NP_002433
OMIM: 603328
HGNC: 7330
Ensembl: ENSG00000135097
Vega: OTTHUMG00000169344
Pharos: O43347(Tbio)
UniProt: O43347
Position
12q24.31
AA seq 362 aa
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE
CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagactgacgcgccccagcccggcctcgcctccccggactcgccgcacgacccctgc
aagatgttcatcgggggactcagttggcagactacgcaggaagggctgcgcgaatacttc
ggccagttcggggaggtgaaggagtgtctggtgatgcgggaccccctgaccaagagatcc
aggggtttcggcttcgtcactttcatggaccaggcgggggtggataaagtgctggcgcaa
tcgcggcacgagctcgactccaaaacaattgaccctaaggtggccttccctcggcgagca
cagcccaagatggtgactcgaacgaagaagatctttgtgggggggctgtcggtgaacacc
acggtggaggacgtgaagcaatattttgagcagtttgggaaggtggacgacgccatgctg
atgtttgacaaaaccaccaaccggcaccgagggttcgggtttgtcacgtttgagagtgag
gacatcgtggagaaagtgtgtgaaattcattttcatgaaatcaacaacaaaatggtggaa
tgtaagaaagctcagccaaaggaggtgatgtcgccaacgggctcagcccgggggaggtct
cgagtcatgccctacggaatggacgccttcatgctgggcatcggcatgctgggttaccca
ggtttccaagccacaacctacgccagccggagttatacaggcctcgcccctggctacacc
taccagttccccgaattccgtgtagagcggacccctctcccgagcgccccagtcctcccc
gagcttacagccattcctctcactgcctacggaccaatggcggcggcagcggcggcagcg
gctgtggttcgagggacaggctctcacccctggacgatggctccccctccaggttcgact
cccagccgcacagggggcttcctggggaccaccagccccggccccatggccgagctctac
ggggcggccaaccaggactcgggggtcagcagttacatcagcgccgccagccctgccccc
agcaccggcttcggccacagtcttgggggccctttgattgccacagccttcaccaatggg
taccactga

DBGET integrated database retrieval system