KEGG   Homo sapiens (human): 4477Help
Entry
4477              CDS       T01001                                 

Gene name
MSMB, HPC13, IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94
Definition
(RefSeq) microseminoprotein beta
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PSP94 TILa VWC
Motif
Other DBs
NCBI-GeneID: 4477
NCBI-ProteinID: NP_002434
OMIM: 157145
HGNC: 7372
Ensembl: ENSG00000263639
Vega: OTTHUMG00000188315
Pharos: P08118(Tbio)
UniProt: P08118
Structure
PDB: 

Position
10q11.22
AA seq 114 aa AA seqDB search
MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETC
TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttctcctgggcagcgttgtgatctttgccaccttcgtgactttatgcaatgca
tcatgctatttcatacctaatgagggagttccaggagattcaaccaggaaatgcatggat
ctcaaaggaaacaaacacccaataaactcggagtggcagactgacaactgtgagacatgc
acttgctacgaaacagaaatttcatgttgcacccttgtttctacacctgtgggttatgac
aaagacaactgccaaagaatcttcaagaaggaggactgcaagtatatcgtggtggagaag
aaggacccaaaaaagacctgttctgtcagtgaatggataatctaa

DBGET integrated database retrieval system