KEGG   Homo sapiens (human): 4486Help
Entry
4486              CDS       T01001                                 

Gene name
MST1R, CD136, CDw136, NPCA3, PTK8, RON, SEA
Definition
(RefSeq) macrophage stimulating 1 receptor
  KO
K05100  macrophage-stimulating 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Drug target
Narnatumab: D10074
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4486 (MST1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4486 (MST1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4486 (MST1R)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  MET family
   4486 (MST1R)
CD molecules [BR:hsa04090]
 Proteins
  4486 (MST1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 4486
NCBI-ProteinID: NP_002438
OMIM: 600168
HGNC: 7381
Ensembl: ENSG00000164078
Vega: OTTHUMG00000156709
Pharos: Q04912(Tchem)
UniProt: Q04912
Structure
PDB: 

Position
3p21.31
AA seq 1400 aa AA seqDB search
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctcccgccgctgcctcagtccttcctgttgctgctgctgttgcctgccaag
cccgcggcgggcgaggactggcagtgcccgcgcaccccctacgcggcctctcgcgacttt
gacgtgaagtacgtggtgcccagcttctccgccggaggcctggtacaggccatggtgacc
tacgagggcgacagaaatgagagtgctgtgtttgtagccatacgcaatcgcctgcatgtg
cttgggcctgacctgaagtctgtccagagcctggccacgggccctgctggagaccctggc
tgccagacgtgtgcagcctgtggcccaggaccccacggccctcccggtgacacagacaca
aaggtgctggtgctggatcccgcgctgcctgcgctggtcagttgtggctccagcctgcag
ggccgctgcttcctgcatgacctagagccccaagggacagccgtgcatctggcagcgcca
gcctgcctcttctcagcccaccataaccggcccgatgactgccccgactgtgtggccagc
ccattgggcacccgtgtaactgtggttgagcaaggccaggcctcctatttctacgtggca
tcctcactggacgcagccgtggctgccagcttcagcccacgctcagtgtctatcaggcgt
ctcaaggctgacgcctcgggattcgcaccgggctttgtggcgttgtcagtgctgcccaag
catcttgtctcctacagtattgaatacgtgcacagcttccacacgggagccttcgtatac
ttcctgactgtacagccggccagcgtgacagatgatcctagtgccctgcacacacgcctg
gcacggcttagcgccactgagccagagttgggtgactatcgggagctggtcctcgactgc
agatttgctccaaaacgcaggcgccggggggccccagaaggcggacagccctaccctgtg
ctgcgggtggcccactccgctccagtgggtgcccaacttgccactgagctgagcatcgcc
gagggccaggaagtactatttggggtctttgtgactggcaaggatggtggtcctggcgtg
ggccccaactctgtcgtctgtgccttccccattgacctgctggacacactaattgatgag
ggtgtggagcgctgttgtgaatccccagtccatccaggcctccggcgaggcctcgacttc
ttccagtcgcccagtttttgccccaacccgcctggcctggaagccctcagccccaacacc
agctgccgccacttccctctgctggtcagtagcagcttctcacgtgtggacctattcaat
gggctgttgggaccagtacaggtcactgcattgtatgtgacacgccttgacaacgtcaca
gtggcacacatgggcacaatggatgggcgtatcctgcaggtggagctggtcaggtcacta
aactacttgctgtatgtgtccaacttctcactgggtgacagtgggcagcccgtgcagcgg
gatgtcagtcgtcttggggaccacctactctttgcctctggggaccaggttttccaggta
cctatccaaggccctggctgccgccacttcctgacctgtgggcgttgcctaagggcatgg
catttcatgggctgtggctggtgtgggaacatgtgcggccagcagaaggagtgtcctggc
tcctggcaacaggaccactgcccacctaagcttactgagttccacccccacagtggacct
ctaaggggcagtacaaggctgaccctgtgtggctccaacttctaccttcacccttctggt
ctggtgcctgagggaacccatcaggtcactgtgggccaaagtccctgccggccactgccc
aaggacagctcaaaactcagaccagtgccccggaaagactttgtagaggagtttgagtgt
gaactggagcccttgggcacccaggcagtggggcctaccaacgtcagcctcaccgtgact
aacatgccaccgggcaagcacttccgggtagacggcacctccgtgctgagaggcttctct
ttcatggagccagtgctgatagcagtgcaacccctctttggcccacgggcaggaggcacc
tgtctcactcttgaaggccagagtctgtctgtaggcaccagccgggctgtgctggtcaat
gggactgagtgtctgctagcacgggtcagtgaggggcagcttttatgtgccacaccccct
ggggccacggtggccagtgtcccccttagcctgcaggtggggggtgcccaggtacctggt
tcctggaccttccagtacagagaagaccctgtcgtgctaagcatcagccccaactgtggc
tacatcaactcccacatcaccatctgtggccagcatctaacttcagcatggcacttagtg
ctgtcattccatgacgggcttagggcagtggaaagcaggtgtgagaggcagcttccagag
cagcagctgtgccgccttcctgaatatgtggtccgagacccccagggatgggtggcaggg
aatctgagtgcccgaggggatggagctgctggctttacactgcctggctttcgcttccta
cccccaccccatccacccagtgccaacctagttccactgaagcctgaggagcatgccatt
aagtttgagtatattgggctgggcgctgtggctgactgtgtgggtatcaacgtgaccgtg
ggtggtgagagctgccagcacgagttccggggggacatggttgtctgccccctgccccca
tccctgcagcttggccaggatggtgccccattgcaggtctgcgtagatggtgaatgtcat
atcctgggtagagtggtgcggccagggccagatggggtcccacagagcacgctccttggt
atcctgctgcctttgctgctgcttgtggctgcactggcgactgcactggtcttcagctac
tggtggcggaggaagcagctagttcttcctcccaacctgaatgacctggcatccctggac
cagactgctggagccacacccctgcctattctgtactcgggctctgactacagaagtggc
cttgcactccctgccattgatggtctggattccaccacttgtgtccatggagcatccttc
tccgatagtgaagatgaatcctgtgtgccactgctgcggaaagagtccatccagctaagg
gacctggactctgcgctcttggctgaggtcaaggatgtgctgattccccatgagcgggtg
gtcacccacagtgaccgagtcattggcaaaggccactttggagttgtctaccacggagaa
tacatagaccaggcccagaatcgaatccaatgtgccatcaagtcactaagtcgcatcaca
gagatgcagcaggtggaggccttcctgcgagaggggctgctcatgcgtggcctgaaccac
ccgaatgtgctggctctcattggtatcatgttgccacctgagggcctgccccatgtgctg
ctgccctatatgtgccacggtgacctgctccagttcatccgctcacctcagcggaacccc
accgtgaaggacctcatcagctttggcctgcaggtagcccgcggcatggagtacctggca
gagcagaagtttgtgcacagggacctggctgcgcggaactgcatgctggacgagtcattc
acagtcaaggtggctgactttggtttggcccgcgacatcctggacagggagtactatagt
gttcaacagcatcgccacgctcgcctacctgtgaagtggatggcgctggagagcctgcag
acctatagatttaccaccaagtctgatgtgtggtcatttggtgtgctgctgtgggaactg
ctgacacggggtgccccaccataccgccacattgacccttttgaccttacccacttcctg
gcccagggtcggcgcctgccccagcctgagtattgccctgattctctgtaccaagtgatg
cagcaatgctgggaggcagacccagcagtgcgacccaccttcagagtactagtgggggag
gtggagcagatagtgtctgcactgcttggggaccattatgtgcagctgccagcaacctac
atgaacttgggccccagcacctcgcatgagatgaatgtgcgtccagaacagccgcagttc
tcacccatgccagggaatgtacgccggccccggccactctcagagcctcctcggcccact
tga

DBGET integrated database retrieval system