KEGG   Homo sapiens (human): 4494Help
Entry
4494              CDS       T01001                                 

Gene name
MT1F, MT1
Definition
(RefSeq) metallothionein 1F
  KO
K14739  metallothionein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    4494 (MT1F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4494 (MT1F)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4494 (MT1F)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4494 (MT1F)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4494 (MT1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallothio
Motif
Other DBs
NCBI-GeneID: 4494
NCBI-ProteinID: NP_005940
OMIM: 156352
HGNC: 7398
Ensembl: ENSG00000198417
Vega: OTTHUMG00000176838
Pharos: P04733(Tbio)
UniProt: P04733
Position
16q13
AA seq 61 aa AA seqDB search
MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC
D
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaactgctcctgcgccgctggtgtctcctgcacctgcgctggttcctgcaag
tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc
tgtagcaagtgtgcccagggctgtgtttgcaaaggggcgtcagagaagtgcagctgctgc
gactga

DBGET integrated database retrieval system