KEGG   Homo sapiens (human): 4507Help
Entry
4507              CDS       T01001                                 

Gene name
MTAP, BDMF, DMSFH, DMSMFH, HEL-249, LGMBF, MSAP, c86fus
Definition
(RefSeq) methylthioadenosine phosphorylase
  KO
K00772  5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4507 (MTAP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     4507 (MTAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PNP_UDP_1 DUF4938
Motif
Other DBs
NCBI-GeneID: 4507
NCBI-ProteinID: NP_002442
OMIM: 156540
HGNC: 7413
Ensembl: ENSG00000099810
Vega: OTTHUMG00000019690
Pharos: Q13126(Tchem)
UniProt: Q13126
Structure
PDB: 

Position
9p21.3
AA seq 283 aa AA seqDB search
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcctctggcaccaccaccaccgccgtgaagattggaataattggtggaacaggcctg
gatgatccagaaattttagaaggaagaactgaaaaatatgtggatactccatttggcaag
ccatctgatgccttaattttggggaagataaaaaatgttgattgcgtcctccttgcaagg
catggaaggcagcacaccatcatgccttcaaaggtcaactaccaggcgaacatctgggct
ttgaaggaagagggctgtacacatgtcatagtgaccacagcttgtggctccttgagggag
gagattcagcccggcgatattgtcattattgatcagttcattgacaggaccactatgaga
cctcagtccttctatgatggaagtcattcttgtgccagaggagtgtgccatattccaatg
gctgagccgttttgccccaaaacgagagaggttcttatagagactgctaagaagctagga
ctccggtgccactcaaaggggacaatggtcacaatcgagggacctcgttttagctcccgg
gcagaaagcttcatgttccgcacctggggggcggatgttatcaacatgaccacagttcca
gaggtggttcttgctaaggaggctggaatttgttacgcaagtatcgccatggcgacagat
tatgactgctggaaggagcacgaggaagcagtttcggtggaccgggtcttaaagaccctg
aaagaaaacgctaataaagccaaaagcttactgctcactaccatacctcagatagggtcc
acagaatggtcagaaaccctccataacctgaagaatatggcccagttttctgttttatta
ccaagacattaa

DBGET integrated database retrieval system