KEGG   Homo sapiens (human): 4508Help
Entry
4508              CDS       T01001                                 

Gene name
ATP6, ATPase6, MTATP6, MT-ATP6, RP
Definition
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H00068  Leber hereditary optic atrophy
H01177  Infantile bilateral striatal necrosis
H01355  Kearns-Sayre syndrome
H01363  NARP syndrome
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4508 (ATP6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    4508 (ATP6)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4508 (ATP6)
   05012 Parkinson disease
    4508 (ATP6)
   05016 Huntington disease
    4508 (ATP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4508 (ATP6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    4508 (ATP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_A
Motif
Other DBs
NCBI-GeneID: 4508
NCBI-ProteinID: YP_003024031
OMIM: 516060
HGNC: 7414
Pharos: P00846(Tbio)
UniProt: P00846 Q0ZFE3
Position
MT
AA seq 226 aa AA seqDB search
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM
HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK
IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA
MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatctgttcgcttcattcattgcccccacaatcctaggcctacccgccgca
gtactgatcattctatttccccctctattgatccccacctccaaatatctcatcaacaac
cgactaatcaccacccaacaatgactaatcaaactaacctcaaaacaaatgataaccata
cacaacactaaaggacgaacctgatctcttatactagtatccttaatcatttttattgcc
acaactaacctcctcggactcctgcctcactcatttacaccaaccacccaactatctata
aacctagccatggccatccccttatgagcgggcacagtgattataggctttcgctctaag
attaaaaatgccctagcccacttcttaccacaaggcacacctacaccccttatccccata
ctagttattatcgaaaccatcagcctactcattcaaccaatagccctggccgtacgccta
accgctaacattactgcaggccacctactcatgcacctaattggaagcgccaccctagca
atatcaaccattaaccttccctctacacttatcatcttcacaattctaattctactgact
atcctagaaatcgctgtcgccttaatccaagcctacgttttcacacttctagtaagcctc
tacctgcacgacaacacataa

DBGET integrated database retrieval system