KEGG   Homo sapiens (human): 4513Help
Entry
4513              CDS       T01001                                 

Gene name
COX2, COII, MTCO2, MT-CO2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00154  Cytochrome c oxidase
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4513 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4513 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4513 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4513 (COX2)
   05012 Parkinson disease
    4513 (COX2)
   05016 Huntington disease
    4513 (COX2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4513 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4513 (COX2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4513 (COX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX2 COX2_TM DUF3100 DPM3 NPCC DUF2921
Motif
Other DBs
NCBI-GeneID: 4513
NCBI-ProteinID: YP_003024029
OMIM: 516040
HGNC: 7421
Pharos: P00403(Tchem)
UniProt: P00403 U5Z487
Position
MT
AA seq 227 aa AA seqDB search
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcacatgcagcgcaagtaggtctacaagacgctacttcccctatcatagaagagctt
atcacctttcatgatcacgccctcataatcattttccttatctgcttcctagtcctgtat
gcccttttcctaacactcacaacaaaactaactaatactaacatctcagacgctcaggaa
atagaaaccgtctgaactatcctgcccgccatcatcctagtcctcatcgccctcccatcc
ctacgcatcctttacataacagacgaggtcaacgatccctcccttaccatcaaatcaatt
ggccaccaatggtactgaacctacgagtacaccgactacggcggactaatcttcaactcc
tacatacttcccccattattcctagaaccaggcgacctgcgactccttgacgttgacaat
cgagtagtactcccgattgaagcccccattcgtataataattacatcacaagacgtcttg
cactcatgagctgtccccacattaggcttaaaaacagatgcaattcccggacgtctaaac
caaaccactttcaccgctacacgaccgggggtatactacggtcaatgctctgaaatctgt
ggagcaaaccacagtttcatgcccatcgtcctagaattaattcccctaaaaatctttgaa
atagggcccgtatttaccctatag

DBGET integrated database retrieval system