KEGG   Homo sapiens (human): 4514Help
Entry
4514              CDS       T01001                                 

Gene name
COX3, COIII, MTCO3, MT-CO3
Definition
(RefSeq) cytochrome c oxidase III
  KO
K02262  cytochrome c oxidase subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00154  Cytochrome c oxidase
Disease
H00068  Leber hereditary optic atrophy (LHON)
H01355  Kearns-Sayre syndrome
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4514 (COX3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4514 (COX3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4514 (COX3)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4514 (COX3)
   05012 Parkinson disease
    4514 (COX3)
   05016 Huntington disease
    4514 (COX3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4514 (COX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4514 (COX3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4514 (COX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX3
Motif
Other DBs
NCBI-GeneID: 4514
NCBI-ProteinID: YP_003024032
OMIM: 516050
HGNC: 7422
Pharos: P00414(Tbio)
UniProt: P00414 Q7GIM7
Position
MT
AA seq 261 aa AA seqDB search
MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRD
VTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG
ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE
YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
NT seq 784 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccaatcacatgcctatcatatagtaaaacccagcccatgacccctaacaggg
gccctctcagccctcctaatgacctccggcctagccatgtgatttcacttccactccata
acgctcctcatactaggcctactaaccaacacactaaccatataccaatgatggcgcgat
gtaacacgagaaagcacataccaaggccaccacacaccacctgtccaaaaaggccttcga
tacgggataatcctatttattacctcagaagtttttttcttcgcaggatttttctgagcc
ttttaccactccagcctagcccctaccccccaattaggagggcactggcccccaacaggc
atcaccccgctaaatcccctagaagtcccactcctaaacacatccgtattactcgcatca
ggagtatcaatcacctgagctcaccatagtctaatagaaaacaaccgaaaccaaataatt
caagcactgcttattacaattttactgggtctctattttaccctcctacaagcctcagag
tacttcgagtctcccttcaccatttccgacggcatctacggctcaacattttttgtagcc
acaggcttccacggacttcacgtcattattggctcaactttcctcactatctgcttcatc
cgccaactaatatttcactttacatccaaacatcactttggcttcgaagccgccgcctga
tactggcattttgtagatgtggtttgactatttctgtatgtctccatctattgatgaggg
tctt

DBGET integrated database retrieval system