KEGG   Homo sapiens (human): 4519Help
Entry
4519              CDS       T01001                                 

Gene name
CYTB, MTCYB, MT-CYB
Definition
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Disease
H00068  Leber hereditary optic atrophy (LHON)
H01355  Kearns-Sayre syndrome
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4519 (CYTB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4519 (CYTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    4519 (CYTB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4519 (CYTB)
   05012 Parkinson disease
    4519 (CYTB)
   05016 Huntington disease
    4519 (CYTB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4519 (CYTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4519 (CYTB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    4519 (CYTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Motif
Other DBs
NCBI-GeneID: 4519
NCBI-ProteinID: YP_003024038
OMIM: 516020
HGNC: 7427
Pharos: P00156(Tbio)
UniProt: P00156 Q0ZFD6
Structure
PDB: 

Position
MT
AA seq 380 aa AA seqDB search
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA
NT seq 1141 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatacgcaaaactaaccccctaataaaattaattaaccactcattcatcgac
ctccccaccccatccaacatctccgcatgatgaaacttcggctcactccttggcgcctgc
ctgatcctccaaatcaccacaggactattcctagccatgcactactcaccagacgcctca
accgccttttcatcaatcgcccacatcactcgagacgtaaattatggctgaatcatccgc
taccttcacgccaatggcgcctcaatattctttatctgcctcttcctacacatcgggcga
ggcctatattacggatcatttctctactcagaaacctgaaacatcggcattatcctcctg
cttgcaactatagcaacagccttcataggctatgtcctcccgtgaggccaaatatcattc
tgaggggccacagtaattacaaacttactatccgccatcccatacattgggacagaccta
gttcaatgaatctgaggaggctactcagtagacagtcccaccctcacacgattctttacc
tttcacttcatcttgcccttcattattgcagccctagcaacactccacctcctattcttg
cacgaaacgggatcaaacaaccccctaggaatcacctcccattccgataaaatcaccttc
cacccttactacacaatcaaagacgccctcggcttacttctcttccttctctccttaatg
acattaacactattctcaccagacctcctaggcgacccagacaattataccctagccaac
cccttaaacacccctccccacatcaagcccgaatgatatttcctattcgcctacacaatt
ctccgatccgtccctaacaaactaggaggcgtccttgccctattactatccatcctcatc
ctagcaataatccccatcctccatatatccaaacaacaaagcataatatttcgcccacta
agccaatcactttattgactcctagccgcagacctcctcattctaacctgaatcggagga
caaccagtaagctacccttttaccatcattggacaagtagcatccgtactatacttcaca
acaatcctaatcctaataccaactatctccctaattgaaaacaaaatactcaaatgggcc
t

DBGET integrated database retrieval system