KEGG   Homo sapiens (human): 4521
Entry
4521              CDS       T01001                                 
Symbol
NUDT1, MTH1
Name
(RefSeq) nudix hydrolase 1
  KO
K17816  8-oxo-dGTP diphosphatase / 2-hydroxy-dATP diphosphatase [EC:3.6.1.55 3.6.1.56]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4521 (NUDT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     4521 (NUDT1)
    3.6.1.56  2-hydroxy-dATP diphosphatase
     4521 (NUDT1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    4521 (NUDT1)
SSDB
Motif
Pfam: NUDIX Nudt16-like
Other DBs
NCBI-GeneID: 4521
NCBI-ProteinID: NP_002443
OMIM: 600312
HGNC: 8048
Ensembl: ENSG00000106268
UniProt: P36639
Structure
Position
7:2242226..2251145
AA seq 156 aa
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
NT seq 471 nt   +upstreamnt  +downstreamnt
atgggcgcctccaggctctataccctggtgctggtcctgcagcctcagcgagttctcctg
ggcatgaaaaagcgaggcttcggggccggccggtggaatggctttgggggcaaagtgcaa
gaaggagagaccatcgaggatggggctaggagggagctgcaggaggagagcggtctgaca
gtggacgccctgcacaaggtgggccagatcgtgtttgagttcgtgggcgagcctgagctc
atggacgtgcatgtcttctgcacagacagcatccaggggacccccgtggagagcgacgaa
atgcgcccatgctggttccagctggatcagatccccttcaaggacatgtggcccgacgac
agctactggtttccactcctgcttcagaagaagaaattccacgggtacttcaagttccag
ggtcaggacaccatcctggactacacactccgcgaggtggacacggtctag

DBGET integrated database retrieval system