KEGG   Homo sapiens (human): 4535Help
Entry
4535              CDS       T01001                                 

Gene name
ND1, MTND1, MT-ND1
Definition
(RefSeq) NADH dehydrogenase, subunit 1 (complex I)
  KO
K03878  NADH-ubiquinone oxidoreductase chain 1 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson's disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy (LHON)
H00473  Mitochondrial complex I deficiency
H01347  MELAS Syndrome
H01365  Leber hereditary optic neuropathy and dystonia (LDYT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4535 (ND1)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4535 (ND1)
  Environmental adaptation
   04714 Thermogenesis
    4535 (ND1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4535 (ND1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4535 (ND1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4535 (ND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADHdh
Motif
Other DBs
NCBI-GeneID: 4535
NCBI-ProteinID: YP_003024026
OMIM: 516000
HGNC: 7455
Pharos: P03886(Tclin)
UniProt: P03886 U5Z754
Structure
PDB: 

Position
MT
AA seq 318 aa AA seqDB search
MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEP
LKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSG
WASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWP
LAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTT
IFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL
LMWYVSMPITISSIPPQT
NT seq 956 nt NT seq  +upstreamnt  +downstreamnt
atacccatggccaacctcctactcctcattgtacccattctaatcgcaatggcattccta
atgcttaccgaacgaaaaattctaggctatatacaactacgcaaaggccccaacgttgta
ggcccctacgggctactacaacccttcgctgacgccataaaactcttcaccaaagagccc
ctaaaacccgccacatctaccatcaccctctacatcaccgccccgaccttagctctcacc
atcgctcttctactatgaacccccctccccatacccaaccccctggtcaacctcaaccta
ggcctcctatttattctagccacctctagcctagccgtttactcaatcctctgatcaggg
tgagcatcaaactcaaactacgccctgatcggcgcactgcgagcagtagcccaaacaatc
tcatatgaagtcaccctagccatcattctactatcaacattactaataagtggctccttt
aacctctccacccttatcacaacacaagaacacctctgattactcctgccatcatgaccc
ttggccataatatgatttatctccacactagcagagaccaaccgaacccccttcgacctt
gccgaaggggagtccgaactagtctcaggcttcaacatcgaatacgccgcaggccccttc
gccctattcttcatagccgaatacacaaacattattataataaacaccctcaccactaca
atcttcctaggaacaacatatgacgcactctcccctgaactctacacaacatattttgtc
accaagaccctacttctaacctccctgttcttatgaattcgaacagcatacccccgattc
cgctacgaccaactcatacacctcctatgaaaaaacttcctaccactcaccctagcatta
cttatatgatatgtctccatacccattacaatctccagcattccccctcaaaccta

DBGET integrated database retrieval system