KEGG   Homo sapiens (human): 4536
Entry
4536              CDS       T01001                                 

Gene name
ND2, MTND2, MT-ND2
Definition
(RefSeq) NADH dehydrogenase subunit 2
  KO
K03879  NADH-ubiquinone oxidoreductase chain 2 [EC:7.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01043  Mutation-inactivated PINK1 to electron transfer in Complex I
N01044  MPP+ to electron transfer in Complex I
N01045  Rotenone to electron transfer in Complex I
N01136  Mutation-caused aberrant TDP43 to electron transfer in Complex I
Disease
H00068  Leber hereditary optic atrophy
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4536 (ND2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4536 (ND2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4536 (ND2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4536 (ND2)
   05012 Parkinson disease
    4536 (ND2)
   05014 Amyotrophic lateral sclerosis
    4536 (ND2)
   05016 Huntington disease
    4536 (ND2)
   05020 Prion disease
    4536 (ND2)
   05022 Pathways of neurodegeneration - multiple diseases
    4536 (ND2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4536 (ND2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4536 (ND2)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     4536 (ND2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4536 (ND2)
SSDB
Motif
Pfam: Proton_antipo_M NADH_dehy_S2_C
Other DBs
NCBI-GeneID: 4536
NCBI-ProteinID: YP_003024027
OMIM: 516001
HGNC: 7456
Pharos: P03891(Tclin)
UniProt: P03891 A0A1X7RBG6 Q7GXY9
Structure
PDB: 
5XTC 5XTD

Position
MT
AA seq 347 aa
MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYF
LTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQ
GTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILA
YSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWL
TPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST
SITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL
NT seq 1042 nt   +upstreamnt  +downstreamnt
attaatcccctggcccaacccgtcatctactctaccatctttgcaggcacactcatcaca
gcgctaagctcgcactgattttttacctgagtaggcctagaaataaacatgctagctttt
attccagttctaaccaaaaaaataaaccctcgttccacagaagctgccatcaagtatttc
ctcacgcaagcaaccgcatccataatccttctaatagctatcctcttcaacaatatactc
tccggacaatgaaccataaccaatactaccaatcaatactcatcattaataatcataata
gctatagcaataaaactaggaatagccccctttcacttctgagtcccagaggttacccaa
ggcacccctctgacatccggcctgcttcttctcacatgacaaaaactagcccccatctca
atcatataccaaatctctccctcactaaacgtaagccttctcctcactctctcaatctta
tccatcatagcaggcagttgaggtggattaaaccaaacccagctacgcaaaatcttagca
tactcctcaattacccacataggatgaataatagcagttctaccgtacaaccctaacata
accattcttaatttaactatttatattatcctaactactaccgcattcctactactcaac
ttaaactccagcaccacgaccctactactatctcgcacctgaaacaagctaacatgacta
acacccttaattccatccaccctcctctccctaggaggcctgcccccgctaaccggcttt
ttgcccaaatgggccattatcgaagaattcacaaaaaacaatagcctcatcatccccacc
atcatagccaccatcaccctccttaacctctacttctacctacgcctaatctactccacc
tcaatcacactactccccatatctaacaacgtaaaaataaaatgacagtttgaacataca
aaacccaccccattcctccccacactcatcgcccttaccacgctactcctacctatctcc
ccttttatactaataatcttat

DBGET integrated database retrieval system