KEGG   Homo sapiens (human): 4538Help
Entry
4538              CDS       T01001                                 

Gene name
ND4, MTND4, MT-ND4, LHON
Definition
(RefSeq) NADH dehydrogenase, subunit 4 (complex I)
  KO
K03881  NADH-ubiquinone oxidoreductase chain 4 [EC:7.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy
H00473  Mitochondrial complex I deficiency
H01355  Kearns-Sayre syndrome
H01365  Leber hereditary optic neuropathy and dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4538 (ND4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4538 (ND4)
  09159 Environmental adaptation
   04714 Thermogenesis
    4538 (ND4)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    4538 (ND4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4538 (ND4)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     4538 (ND4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4538 (ND4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Motif
Other DBs
NCBI-GeneID: 4538
NCBI-ProteinID: YP_003024035
OMIM: 516003
HGNC: 7459
Pharos: P03905(Tclin)
UniProt: P03905 H9EC08
Structure
PDB: 

Position
MT
AA seq 459 aa AA seqDB search
MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP
LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI
FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT
LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG
YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL
LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT
HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
NT seq 1378 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaactaatcgtcccaacaattatattactaccactgacatgactttccaaaaaa
cacataatttgaatcaacacaaccacccacagcctaattattagcatcatccctctacta
ttttttaaccaaatcaacaacaacctatttagctgttccccaaccttttcctccgacccc
ctaacaacccccctcctaatactaactacctgactcctacccctcacaatcatggcaagc
caacgccacttatccagtgaaccactatcacgaaaaaaactctacctctctatactaatc
tccctacaaatctccttaattataacattcacagccacagaactaatcatattttatatc
ttcttcgaaaccacacttatccccaccttggctatcatcacccgatgaggcaaccagcca
gaacgcctgaacgcaggcacatacttcctattctacaccctagtaggctcccttccccta
ctcatcgcactaatttacactcacaacaccctaggctcactaaacattctactactcact
ctcactgcccaagaactatcaaactcctgagccaacaacttaatatgactagcttacaca
atagcttttatagtaaagatacctctttacggactccacttatgactccctaaagcccat
gtcgaagcccccatcgctgggtcaatagtacttgccgcagtactcttaaaactaggcggc
tatggtataatacgcctcacactcattctcaaccccctgacaaaacacatagcctacccc
ttccttgtactatccctatgaggcataattataacaagctccatctgcctacgacaaaca
gacctaaaatcgctcattgcatactcttcaatcagccacatagccctcgtagtaacagcc
attctcatccaaaccccctgaagcttcaccggcgcagtcattctcataatcgcccacggg
cttacatcctcattactattctgcctagcaaactcaaactacgaacgcactcacagtcgc
atcataatcctctctcaaggacttcaaactctactcccactaatagctttttgatgactt
ctagcaagcctcgctaacctcgccttaccccccactattaacctactgggagaactctct
gtgctagtaaccacgttctcctgatcaaatatcactctcctacttacaggactcaacata
ctagtcacagccctatactccctctacatatttaccacaacacaatggggctcactcacc
caccacattaacaacataaaaccctcattcacacgagaaaacaccctcatgttcatacac
ctatcccccattctcctcctatccctcaaccccgacatcattaccgggttttcctctt

DBGET integrated database retrieval system