KEGG   Homo sapiens (human): 4540Help
Entry
4540              CDS       T01001                                 

Gene name
ND5, MTND5, MT-ND5
Definition
(RefSeq) NADH dehydrogenase, subunit 5 (complex I)
  KO
K03883  NADH-ubiquinone oxidoreductase chain 5 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy (LHON)
H00473  Mitochondrial complex I deficiency
H01347  MELAS Syndrome
H01355  Kearns-Sayre syndrome
H01356  Myoclonic Epilepsy and Ragged-Red Fiber Disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4540 (ND5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4540 (ND5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4540 (ND5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05012 Parkinson disease
    4540 (ND5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4540 (ND5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4540 (ND5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4540 (ND5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proton_antipo_M NADH5_C Proton_antipo_N
Motif
Other DBs
NCBI-GeneID: 4540
NCBI-ProteinID: YP_003024036
OMIM: 516005
HGNC: 7461
Pharos: P03915(Tclin)
UniProt: P03915 U5ZC31
Structure
PDB: 

Position
MT
AA seq 603 aa AA seqDB search
MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTFIISLFPTTMFMCLDQE
VIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKY
LLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDI
GFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGP
TPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKK
IVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMG
GLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSITLIATSLTS
AYSTRMILLTLTGQPRFPTLTNINENNPTLLNPIKRLAAGSLFAGFLITNNISPASPFQT
TIPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYL
GLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLL
LIT
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
ataaccatgcacactactataaccaccctaaccctgacttccctaattccccccatcctt
accaccctcgttaaccctaacaaaaaaaactcatacccccattatgtaaaatccattgtc
gcatccacctttattatcagtctcttccccacaacaatattcatgtgcctagaccaagaa
gttattatctcgaactgacactgagccacaacccaaacaacccagctctccctaagcttc
aaactagactacttctccataatattcatccctgtagcattgttcgttacatggtccatc
atagaattctcactgtgatatataaactcagacccaaacattaatcagttcttcaaatat
ctactcatcttcctaattaccatactaatcttagttaccgctaacaacctattccaactg
ttcatcggctgagagggcgtaggaattatatccttcttgctcatcagttgatgatacgcc
cgagcagatgccaacacagcagccattcaagcaatcctatacaaccgtatcggcgatatc
ggtttcatcctcgccttagcatgatttatcctacactccaactcatgagacccacaacaa
atagcccttctaaacgctaatccaagcctcaccccactactaggcctcctcctagcagca
gcaggcaaatcagcccaattaggtctccacccctgactcccctcagccatagaaggcccc
accccagtctcagccctactccactcaagcactatagttgtagcaggaatcttcttactc
atccgcttccaccccctagcagaaaatagcccactaatccaaactctaacactatgctta
ggcgctatcaccactctgttcgcagcagtctgcgcccttacacaaaatgacatcaaaaaa
atcgtagccttctccacttcaagtcaactaggactcataatagttacaatcggcatcaac
caaccacacctagcattcctgcacatctgtacccacgccttcttcaaagccatactattt
atgtgctccgggtccatcatccacaaccttaacaatgaacaagatattcgaaaaatagga
ggactactcaaaaccatacctctcacttcaacctccctcaccattggcagcctagcatta
gcaggaatacctttcctcacaggtttctactccaaagaccacatcatcgaaaccgcaaac
atatcatacacaaacgcctgagccctatctattactctcatcgctacctccctgacaagc
gcctatagcactcgaataattcttctcaccctaacaggtcaacctcgcttccccaccctt
actaacattaacgaaaataaccccaccctactaaaccccattaaacgcctggcagccgga
agcctattcgcaggatttctcattactaacaacatttcccccgcatcccccttccaaaca
acaatccccctctacctaaaactcacagccctcgctgtcactttcctaggacttctaaca
gccctagacctcaactacctaaccaacaaacttaaaataaaatccccactatgcacattt
tatttctccaacatactcggattctaccctagcatcacacaccgcacaatcccctatcta
ggccttcttacgagccaaaacctgcccctactcctcctagacctaacctgactagaaaag
ctattacctaaaacaatttcacagcaccaaatctccacctccatcatcacctcaacccaa
aaaggcataattaaactttacttcctctctttcttcttcccactcatcctaaccctactc
ctaatcacataa

DBGET integrated database retrieval system