KEGG   Homo sapiens (human): 4541Help
Entry
4541              CDS       T01001                                 

Gene name
ND6, MTND6, MT-ND6
Definition
(RefSeq) NADH dehydrogenase, subunit 6 (complex I)
  KO
K03884  NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy
H00473  Mitochondrial complex I deficiency
H01347  MELAS Syndrome
H01355  Kearns-Sayre syndrome
H01365  Leber hereditary optic neuropathy and dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4541 (ND6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4541 (ND6)
  09159 Environmental adaptation
   04714 Thermogenesis
    4541 (ND6)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    4541 (ND6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4541 (ND6)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     4541 (ND6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4541 (ND6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_q3
Motif
Other DBs
NCBI-GeneID: 4541
NCBI-ProteinID: YP_003024037
OMIM: 516006
HGNC: 7462
Pharos: P03923(Tclin)
UniProt: P03923 U5Z977
Structure
PDB: 

Position
MT
AA seq 174 aa AA seqDB search
MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYL
GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS
VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatgctttgtttctgttgagtgtgggtttagtaatggggtttgtggggttttct
tctaagccttctcctatttatgggggtttagtattgattgttagcggtgtggtcgggtgt
gttattattctgaattttgggggaggttatatgggtttaatagtttttttaatttattta
gggggaatgatggttgtctttggatatactacagcgatggctattgaggagtatcctgag
gcatgggggtcaggggttgaggtcttggtgagtgttttagtggggttagcgatggaggta
ggattggtgctgtgggtgaaagagtatgatggggtggtggttgtggtaaactttaatagt
gtaggaagctgaataatttatgaaggagaggggtcagggttgattcgggaggatcctatt
ggtgcgggggctttgtatgattatgggcgttgattagtagtagttactggttgaacattg
tttgttggtgtatatattgtaattgagattgctcgggggaatagg

DBGET integrated database retrieval system