KEGG   Homo sapiens (human): 4544Help
Entry
4544              CDS       T01001                                 

Gene name
MTNR1B, FGQTL2, MEL-1B-R, MT2
Definition
(RefSeq) melatonin receptor 1B
  KO
K04286  melatonin receptor type 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
Disease
H00409  Type 2 diabetes mellitus
Drug target
Agomelatine: D02578
Melatonin: D08170
Ramelteon: D02689
Tasimelteon: D09388
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4544 (MTNR1B)
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    4544 (MTNR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4544 (MTNR1B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Melatonin
    4544 (MTNR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 4544
NCBI-ProteinID: NP_005950
OMIM: 600804
HGNC: 7464
Ensembl: ENSG00000134640
Vega: OTTHUMG00000167364
Pharos: P49286(Tclin)
UniProt: P49286
Position
11q14.3
AA seq 362 aa AA seqDB search
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaacggctccttcgccaactgctgcgaggcgggcgggtgggcagtgcgcccg
ggctggtcgggggctggcagcgcgcggccctccaggacccctcgacctccctgggtggct
ccagcgctgtccgcggtgctcatcgtcaccaccgccgtggacgtcgtgggcaacctcctg
gtgatcctctccgtgctcaggaaccgcaagctccggaacgcaggtaatttgttcttggtg
agtctggcattggctgacctggtggtggccttctacccctacccgctaatcctcgtggcc
atcttctatgacggctgggccctgggggaggagcactgcaaggccagcgcctttgtgatg
ggcctgagcgtcatcggctctgtcttcaatatcactgccatcgccattaaccgctactgc
tacatctgccacagcatggcctaccaccgaatctaccggcgctggcacacccctctgcac
atctgcctcatctggctcctcaccgtggtggccttgctgcccaacttctttgtggggtcc
ctggagtacgacccacgcatctattcctgcaccttcatccagaccgccagcacccagtac
acggcggcagtggtggtcatccacttcctcctccctatcgctgtcgtgtccttctgctac
ctgcgcatctgggtgctggtgcttcaggcccgcaggaaagccaagccagagagcaggctg
tgcctgaagcccagcgacttgcggagctttctaaccatgtttgtggtgtttgtgatcttt
gccatctgctgggctccacttaactgcatcggcctcgctgtggccatcaacccccaagaa
atggctccccagatccctgaggggctatttgtcactagctacttactggcttatttcaac
agctgcctgaatgccattgtctatgggctcttgaaccaaaacttccgcagggaatacaag
aggatcctcttggccctttggaacccacggcactgcattcaagatgcttccaagggcagc
cacgcggaggggctgcagagcccagctccacccatcattggtgtgcagcaccaggcagat
gctctctag

DBGET integrated database retrieval system