KEGG   Homo sapiens (human): 4582Help
Entry
4582              CDS       T01001                                 

Gene name
MUC1, ADMCKD, ADMCKD1, CA_15-3, CD227, EMA, H23AG, KL-6, MAM6, MCD, MCKD, MCKD1, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM
Definition
(RefSeq) mucin 1, cell surface associated
  KO
K06568  mucin-1
Organism
hsa  Homo sapiens (human)
Disease
H00541  Autosomal dominant tubulointerstitial kidney disease (ADTKD)
H02012  Medullary cystic kidney disease (MCKD)
Drug target
Arcitumomab: D02977
Emepepimut-S: D09895
Technetium (99mTc) arcitumomab: D06028
Yttrium Y 90 clivatuzumab tetraxetan: D09700
Brite
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    4582 (MUC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4582 (MUC1)
  Exosomal proteins of breast cancer cells
   4582 (MUC1)
  Exosomal proteins of bladder cancer cells
   4582 (MUC1)
CD molecules [BR:hsa04090]
 Proteins
  4582 (MUC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEA Collectrin Stevor IncA
Motif
Other DBs
NCBI-GeneID: 4582
NCBI-ProteinID: NP_001191215
OMIM: 158340
HGNC: 7508
Ensembl: ENSG00000185499
Vega: OTTHUMG00000035681
Pharos: P15941(Tbio)
UniProt: P15941 A0A087X2A4
Structure
PDB: 

Position
1q22
AA seq 484 aa AA seqDB search
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK
NAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGST
TPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGST
APPVHNVTSASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTK
TDASSTHHSTVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQR
DISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASR
YNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNY
GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAAT
SANL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgggcacccagtctcctttcttcctgctgctgctcctcacagtgcttacagct
accacagcccctaaacccgcaacagttgttacgggttctggtcatgcaagctctacccca
ggtggagaaaaggagacttcggctacccagagaagttcagtgcccagctctactgagaag
aatgctgtgagtatgaccagcagcgtactctccagccacagccccggttcaggctcctcc
accactcagggacaggatgtcactctggccccggccacggaaccagcttcaggttcagct
gccacctggggacaggatgtcacctcggtcccagtcaccaggccagccctgggctccacc
accccgccagcccacgatgtcacctcagccccggacaacaagccagccccgggctccacc
gcccccccagcccacggtgtcacctcggccccggacaccaggccggccccgggctccacc
gcccccccagcccatggtgtcacctcggccccggacaacaggcccgccttgggctccacc
gcccctccagtccacaatgtcacctcggcctcaggctctgcatcaggctcagcttctact
ctggtgcacaacggcacctctgccagggctaccacaaccccagccagcaagagcactcca
ttctcaattcccagccaccactctgatactcctaccacccttgccagccatagcaccaag
actgatgccagtagcactcaccatagcacggtacctcctctcacctcctccaatcacagc
acttctccccagttgtctactggggtctctttctttttcctgtcttttcacatttcaaac
ctccagtttaattcctctctggaagatcccagcaccgactactaccaagagctgcagaga
gacatttctgaaatgtttttgcagatttataaacaagggggttttctgggcctctccaat
attaagttcaggccaggatctgtggtggtacaattgactctggccttccgagaaggtacc
atcaatgtccacgacgtggagacacagttcaatcagtataaaacggaagcagcctctcga
tataacctgacgatctcagacgtcagcgtgagtgatgtgccatttcctttctctgcccag
tctggggctggggtgccaggctggggcatcgcgctgctggtgctggtctgtgttctggtt
gcgctggccattgtctatctcattgccttggctgtctgtcagtgccgccgaaagaactac
gggcagctggacatctttccagcccgggatacctaccatcctatgagcgagtaccccacc
taccacacccatgggcgctatgtgccccctagcagtaccgatcgtagcccctatgagaag
gtttctgcaggtaatggtggcagcagcctctcttacacaaacccagcagtggcagccact
tctgccaacttgtag

DBGET integrated database retrieval system