KEGG   Homo sapiens (human): 4584Help
Entry
4584              CDS       T01001                                 

Gene name
MUC3A, MUC-3A, MUC3
Definition
(RefSeq) mucin 3A, cell surface associated
  KO
K22016  mucin-3/17
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4584 (MUC3A)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    4584 (MUC3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 4584
NCBI-ProteinID: NP_005951
OMIM: 158371
HGNC: 7513
Ensembl: ENSG00000169894
Vega: OTTHUMG00000157038
Pharos: Q02505(Tdark)
UniProt: Q02505 Q9H3Q6
Position
7q22.1
AA seq 3323 aa AA seqDB search
MQLLGLLGLLWMLKASPWATGTLSTATSISQVPFPRAEAASAVLSNSPHSRDLAGWPLGV
PQLASPAPGHRENAPMTLTTSPHDTLISETLLNSPVSSNTSTTPTSKFAFKVETTPPTVL
VYSATTECVYPTSFIITISHPTSICVTTTQVAFTSSYTSTPVTQKPVTTVTSTYSMTTTE
KGTSAMTSSPSTTTARETPIVTVTPSSVSATDTTFHTTISSTTRTTERTPLPTGSIHTTT
SPTPVFTTLKTAVTSTSPITSSITSTNTVTSMTTTASQPTATNTLSSPTRTILSSTPVLS
TETITSGITNTTPLSTLVTTLPTTISRSTPTSETTYTTSPTSTVTDSTTKIAYSTSMTGT
LSTETSLPPTSSSLPTTETATTPMTNLVTTTTEISSHSTPSFSSSTIYSTVSTSTTAISS
LPPTSGTMVTSTTMTPSSLSTDIPFTTPTTITHHSVGSTGFLTTATDLTSTFTVSSSSAM
STSVIPSSPSIQNTETSSLVSMTSATTPNVRPTFVSTLSTPTSSLLTTFPATYSFSSSMS
ASSAGTTHTESISSPPASTSTLHTTAESTLAPTTTTSFTTSTTMEPPSTTAATTGTGQTT
FTSSTATFPETTTPTPTTDMSTESLTTAMTSPPITSSVTSTNTVTSMTTTTSPPTTTNSF
TSLTSMPLSSTPVPSTEVVTSGTINTIPPSILVTTLPTPNASSMTTSETTYPNSPTGPGT
NSTTEITYPTTMTETSSTATSLPPTSPLVSTAKTAKTPTTNLVTTTTKTTSHSTTSFTSS
TVYSTASTYTTAITSVPTTLGTMVTSTSMISSTVSTGIPTSQPTTITPSSVGISGSLPMM
TDLTSVYTVSNMSARPTTVIPSSPTVQNTEISISVSMTSATTPSGGPTFTSTENTPTRSL
LTSFPMTHSFSSSMSESSAGTTHTESISSPRGTTSTLHTTVESTPSPTTTTSFTTSTMME
PPSSTVSTTGRGQTTFPSSTATFPETTTLTPTTDISTVSLTTAMTSPPPVSSSITPTNTM
TSMRTTTYWPTATNTLSPLTSSILSSTPVPSTEMITSHTTNTTPLSTLVTTLLTTITRST
PTSETTYPTSPTSIVSDSTTEITYSTSITGTLSTATTLPPTSSSLPTTETATMTPTTTLI
TTTPNTTSLSTPSFTSSTIYSTVSTSTTAISSASPTSGTMVTSTTMTPSSLSTDTPSTTP
TTITYPSVGSTGFLTTATDLTSTFTVSSSSAMSTSVIPSSPSIQNTETSSLVSMTSATTP
SLRPTITSTDSTLTSSLLTTFPSTYSFSSSMSASSAGTTHTETISSLPASTNTIHTTAES
ALAPTTTTSFTTSPTMEPPSTTVATTGTGQTTFPSSTATFLETTTLTPTTDFSTESLTTA
MTSTPPITSSITPTDTMTSMRTTTSWPTATNTLSPLTSSILSSTPVPSTEVTTSHTTNTN
PVSTLVTTLPITITRSTLTSETAYPSSPTSTVTESTTEITYPTTMTETSSTATSLPPTSS
LVSTAETAKTPTTNLVTTTTKTTSHSTTSFTSSTIYSTASTPTTAITSVPTTLGTMVTST
SMIPSTVSTGIPTSQPTTITPSSVGISGSLPMMTDLTSVYTVSSMSARPTSVIPSSPTVQ
NTETSIFVSMMSATTPSGGPTFTSTENTPTRSLLTSFPVTHSFSSSMSASSVGTTHTQSI
SSPPAITSTLHTTAESTPSPTTTMSFTTFTKMETPSSTVATTGTGQTTFTSSTATSPKTT
TLTPTSDISTGSFKTAVSSTPPITSSITSTYTVTSMTTTTPLGPTATNTLPSFTSSVSSS
TPVPSTEAITSGTTNTTPLSTLVTTFSNSDTSSTPTSETTYPTSLTSALTDSTTRTTYST
NMTGTLSTVTSLRPTSSSLLTTVTATVPTTNLVTTTTKITSHSTPSFTSSIATTETPSHS
TPRFTSSITTTETPSHSTPRFTSSITNTKTTSHSSPSFTSSITTTETTSHNTPSLTSSIT
TTKTTSHSTPSYTSLITTTTTTSHSTPSFTSSITTTETTSHNTPSLTSSITTTETTSHST
PSFTSSITTETTSHSTPSFTSLITITEITSHSTLSYTTSITTTETPSHSTLSFTSSITTT
ETTSHSTPSFTSSITTSEMPSHSTPSFTSSITTTENATHSTPNFTSSITTTETTSHSTPS
FTSLITTTETTSHRWGTTETTSYSTPSFTSSNTITETTSHSTPSYITSITTTETPSSSTP
SFSSSITTTETTSHSTPGFTSSITTTETTSHSTPSFTSSITTTETTSHDTPSFTSSITTS
ETPSHSTPSSTSLITTTKTTSHSTPSFTSSITTTETTSHSAHSFTSSITTTETTSHNTRS
FTSSITTTETNSHSTTSFTSSITTTETTSHSTPSFSSSITTTETPLHSTPGLTSWVTTTK
TTSHITPGLTSSITTTETTSHSTPGFTSSITTTETTSESTPSLSSSTIYSTVSTSTTAIT
SHFTTSETAVTPTPVTPSSLSTDIPTTSLRTLTPSSVGTSTSLTTTTDFPSIPTDISTLP
TRTHIISSSPSIQSTETSSLVGTTSPTMSTVRMTLRITENTPISSFSTSIVVIPETPTQT
PPVLTSATGTQTSPAPTTVTFGSTDSSTSTLHTLTPSTALSTIVSTSQVPIPSTHSSTLQ
TTPSTPSLQTSLTSTSEFTTESFTRGSTSTNAILTSFSTIIWSSTPTIIMSSSPSSASIT
PVFSTTIHSVPSSPYIFSTENVGSASITGFPSLSSSATTSTSSTSSSLTTALTEITPFSY
ISLPSTTPCPGTITITIVPASPTDPCVEMDPSTEATSPPTTPLTVFPFTTEMVTCPTSIS
IQTTLTTYMDTSSMMPESESSISPNASSSTGTGTVPTNTVFTSTRLPTSETWLSNSSVIP
LPLPGVSTIPLTMKPSSSLPTILRTSSKSTHPSPPTTRTSETPVATTQTPTTLTSRRTTR
ITSQMTTQSTLTTTAGTCDNGGTWEQGQCACLPGFSGDRCQLQTRCQNGGQWDGLKCQCP
STFYGSSCEFAVEQVDLDVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKI
FADMQGFTFKGVEILSLRNGSIVVDYLVLLEMPFSPQLESEYEQVKTTLKEGLQNASQDV
NSCQDSQTLCFKPDSIKVNNNSKTELTPAAICRRAAPTGYEEFYFPLVEATRLRCVTKCT
SGVDNAIDCHQGQCVLETSGPTCRCYSTDTHWFSGPRCEVAVHWRALVGGLTAGAALLVL
LLLALGVRAVRSGWWGGQRRGRSWDQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFYV
ALENVDTTMKVHIKRPEMTSSSV
NT seq 9972 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgttggggctcctcggcctcctctggatgctcaaggcctccccgtgggccaca
ggaactttatccacggccacatccatctctcaagtgcctttccccagagcagaagcagcc
agcgctgtgctcagcaattctccacactccagagacctggctgggtggccacttggtgtc
ccccagctcgcctctcctgctcctggccacagggaaaatgcacctatgacactcactacc
tccccccatgacacactcatctctgaaacattgctcaactctccagtcagttccaacacc
tcaaccaccccgacgtccaagtttgccttcaaggttgaaaccactccacccaccgtgttg
gtctattcagccaccactgagtgcgtgtatccaacgagctttataatcaccatctcccac
cccacctccatctgtgtgaccacgacgcaggtggccttcaccagctcttacacctcgact
cccgtgacacagaagccagtgaccaccgtcaccagtacttactctatgaccactactgag
aaaggaacgtcagccatgacatcttctccctctaccaccactgcaagggaaactcccata
gtgacagtgacaccctcctctgtgtcagccacagacacaaccttccacactacaatctcg
tctacaactagaaccacagaaaggactcccctgcccactggaagcatccatacaaccacg
tccccaaccccagtatttactactctcaaaacagcagtgacttccacttcccccatcact
tcttcaatcacttccacaaatacagtgacttctatgacaacgaccgcctcccagcccaca
gccactaatacattgtcatcacccactaggaccattttatcttccacacctgtcctgagc
acagaaacaatcaccagtggtatcacaaacaccacccccctatccaccttggtgaccaca
ctccccactaccatcagcaggtctacacctacatctgagaccacctacactacttctccc
accagcactgtcacagactccactaccaaaatcgcctactccacaagtatgacaggtaca
ttgtccacagagacttctctcccacccacctcttcctctctcccaaccacagaaacagcc
acgactcctatgacaaacttggtaaccaccaccactgagatctcctcccacagtactccc
agcttctcttcatcaaccatctactccacagtcagcacatccacaactgccatctcctca
cttccccctacctcaggtactatggtgacttccacaaccatgaccccatcttctctgagt
acagacatccctttcacaacaccaacaactatcacccaccattctgtgggctctaccggt
ttcctgactacagcaacagacctcacatcaacattcacggtttccagttcctcagcaatg
tccacgagtgtcattccatcttcccccagcattcagaatacagaaacctcatcccttgtc
agcatgacctctgccactactcccaatgtgagaccaacttttgtaagtacactcagcact
cctacaagttccctcctgacgaccttcccagcaacatattcattttcatcttccatgtct
gccagcagtgctgggaccactcacacagagagtatctcctcacctccagccagcaccagt
acactccacacaacagctgaatccaccctggcacccactaccaccacctcattcacaact
tccacaactatggaaccaccttcaaccactgcagcaactacaggaacaggtcagaccacc
ttcaccagctctacagccacatttcctgagaccaccacaccgactcctacaactgacatg
tccacagaatctctcacaacagccatgacttctcctcccatcacttcatcagtcacttcc
acaaatacagtgacttctatgacaactacgacctctcctcccacaaccaccaattctttt
acatcactgaccagtatgcctctgtcttctacacctgtcccaagcacagaagtagtcacc
agtggcaccataaacacaatccctccatctatcttggtgaccacactccccactccaaat
gcttcatctatgactacatctgagaccacctatcctaattctccgactggtcctggtaca
aactccacgacggaaatcacctatcccaccactatgacagagacatcatccactgccacc
tctcttccacccacctctcccttggtctcaactgcaaaaacagccaaaactcctaccaca
aacttggtaaccaccaccaccaagaccacctcacatagtaccaccagcttcacttcttca
accgtctactccacagccagcacatacacaactgccatcacctcagttcccactacgttg
ggtaccatggtaacttctacatccatgatctcatctactgtgagtacaggtatccctacc
tcacaaccaacaaccatcactccctcatccgtgggcatcagtggttcattacctatgatg
acagacctcacctcagtgtacacagtctctaacatgtctgcaaggccaacaactgtcatt
ccctcatctcccactgtccagaatacagaaatctcaatctctgttagcatgacgtctgct
accactcccagtggaggaccaactttcacaagtactgagaacactccaacaaggtccctc
ctgacaagctttccaatgacacattcattctcttcttctatgtctgaaagtagtgctggg
accactcacacagagagtatctcctcacctcgaggcaccaccagtacactccacacaaca
gttgaatccaccccatcacccactaccaccacctcatttaccacatccacaatgatggaa
ccaccttcatccactgtatcaactacaggcagaggtcagaccacctttcccagctctaca
gccacattccctgagaccactacactgactcctacaactgacatttctacagtatctctc
acaacagccatgacttctcctccccccgtcagttcttcaatcactcccaccaatacaatg
acttctatgagaactacaacctattggcccacagccactaatacattatcaccactcacc
agtagcattttatcttctacacctgtcccaagcacagaaatgatcaccagtcataccaca
aacaccacccctctatccaccttggtgactacactcctcactaccatcaccagatctaca
cctacatctgagaccacctaccctacttctcccaccagcattgtctcagactccacgact
gaaatcacctattccacaagtataacaggtacattgtccactgccactactctcccaccc
acctcttcctctctcccaaccacagaaacagccacgatgactcctaccacaaccttgata
accaccacccctaataccacctcccttagtacccccagcttcacttcttcaaccatctac
tccacagtcagcacatccacaactgccatctcctcagcttcccctacctcaggtaccatg
gtaacttccacaaccatgaccccatcttctctgagtacagacaccccttccacaacacca
acaactatcacctacccttctgtgggctctaccggtttcctgactacagcaacagacctc
acatcaacattcactgtttccagttcctcagcaatgtccacaagtgtcattccatcttcc
cccagcatccagaatacagaaacctcatcccttgtcagcatgacctctgccaccactccc
agtttgagaccaactatcacaagtactgacagcactctaacaagttccctcctgacgacc
ttcccaagtacatattcattttcatcttccatgtctgccagcagtgcagggaccactcac
acagagactatttcctcacttccagccagcaccaatacaatccacacaacagctgaatcc
gccctggcacccactaccaccacctcattcaccacatccccaacgatggaaccaccttca
accactgtagcgactacaggcacaggtcagaccaccttccccagctctacagccacattc
cttgagaccaccacactgactcctacaactgacttttctacagaatctctcacaacagcc
atgacttctactccccccatcacttcttcaatcactcccaccgatacaatgacttctatg
agaactacgacctcttggcccacagccactaatacgttatcaccactcaccagtagcatt
ttatcttctacacctgtcccaagcacagaggtgaccaccagtcataccacaaacaccaat
cctgtatccacgttggtgactacactccccattaccatcaccaggtctacacttacatct
gagaccgcctaccctagttctcccacaagcactgtcacagagtccacaactgaaatcacc
tatcccaccactatgacagagacatcatctactgccacctctcttccacccacctcttcc
ttggtctcaaccgcagaaacagccaaaactcctaccacaaacttggtaaccaccaccacc
aagaccacctcacatagtaccaccagcttcacttcttcaaccatctactccacagccagc
acacccaccactgccatcacctcagttcccactaccttgggtaccatggtgacttctaca
tccatgatcccatctactgtgagtacaggtatccctacctcacaaccaacaactattact
ccctcatccgtgggcatcagtggttcattacctatgatgacagacctcacctcagtgtac
acagtctccagcatgtctgcaaggccaacaagtgtcattccttcatctcccactgtccag
aatacagaaacctcaatctttgttagcatgatgtctgctaccactcccagtggaggacca
actttcacaagtactgagaacactccaacaaggtccctcctgacaagctttccagtgaca
cattcattttcctcttccatgtctgccagcagtgtagggaccactcacacccagagtatc
tcctcacccccagccatcaccagtacactccacacaacagctgaatccaccccatcacct
acaaccaccatgtcattcacaacatttacaaagatggaaacaccttcatccactgtagca
actacaggcacaggtcagactacattcaccagttcaacagccacatcccctaagaccacc
acactgactcctacctctgacatttccacaggatctttcaaaacagccgtgagttctact
ccccccatcacttcttcaatcacctccacatatacggtgacttcgatgacaactaccacc
cctctagggcccacagccactaatacgttaccatcatttaccagtagcgtttcatcttct
acgcctgtcccaagtacagaagcgatcaccagtggtaccacaaacaccacccctctatct
acattggtgaccacattctccaattccgacaccagttctacacctacatctgagaccacc
taccctacttctcttactagtgctctcacagattccacgaccagaaccacctattccacc
aatatgacaggtacattgtccactgtgacctctcttcgacccacctcttcctctctcctc
accacagtaacagccacagttccaacaacaaacttggtaaccacgaccaccaagatcacc
tcacacagtactcctagcttcacttcttcaatcgcaaccaccgagaccccctcacacagt
actcccagattcacttcttcaatcaccactaccgagaccccctcacacagtactcccaga
ttcacttcttcaatcaccaataccaagaccacctcacacagctctcccagcttcacttct
tcgatcaccaccaccgagaccacatcccacaatactcccagcctcacttcttcaatcacc
accaccaagaccacctcacacagtactcccagctacacttctttgatcaccacaaccacc
accacctcacacagtactcccagcttcacttcttccatcaccaccactgagaccacatcc
cacaatactcccagcttgacttcttcgatcacaaccaccgagaccacatcccatagtact
cccagcttcacttcttcgatcaccaccgagaccacatcccacagtactcccagcttcact
tcattgatcaccatcaccgagatcacctcacacagtactctcagctacactacctcaatc
accaccaccgagaccccctcacacagtactctcagcttcacttcttcaatcaccaccact
gagaccacctcacacagtactcccagcttcacttcctcaatcaccacctctgagatgccc
tcacacagtactcccagcttcacttcttcgatcaccaccactgagaacgccacacacagt
actcccaacttcacttcttcaatcaccaccaccgagaccacatcccacagtactcccagc
ttcacttctttgatcaccaccacggagaccacctcacacaggtgggggaccaccgagacc
acatcctacagtactcccagcttcacttcttcaaataccatcactgagaccacctcacac
agtactcccagctacattacctcaatcaccaccaccgagaccccctcaagcagtactccc
agcttcagttcttcgatcaccaccactgagaccacatcccacagtactcccggcttcact
tcttcaatcaccaccactgagactacatcccacagtactcccagcttcacttcttcgatc
accaccactgagaccacctcacatgatactcccagcttcacttcttcaatcaccaccagt
gagaccccctcacacagtactcccagctccacttctttaatcaccaccaccaagaccacc
tcacacagtactcccagcttcacttcttcgatcaccaccacggagaccacctcacacagt
gctcacagcttcacttcttcgatcaccaccaccgagaccacctcacacaatactcgcagc
ttcacttcttcgatcaccaccaccgagaccaactctcacagtactaccagcttcacttct
tcgatcaccaccaccgagaccacctcacacagtactcccagcttcagttcttcaatcacc
accactgagacccccttacacagtactcctggcctcacttcgtgggtcaccaccaccaag
accacctcacacattactcctggcctcacttcttcaatcaccaccactgagactacctca
cacagtactcctggcttcacttcttcaatcaccaccactgagaccacctcagagagtact
cccagcctcagttcttcaaccatctactccacagtcagcacatccacaactgccatcacc
tcacattttactacctcagagactgcggtgactcccacacctgtaaccccatcttctctg
agtacagacatcccgaccacaagcctacgaactctcaccccttcgtctgtgggcaccagc
acttcattgactacaaccacagactttccctctatacccactgatatcagtaccttacca
actcgaacacacatcatttcatcttctccctccatccaaagtacagaaacctcatccctt
gtgggcaccacctctcccaccatgtccactgtgagaatgaccctcagaattactgagaac
accccaatcagttcctttagcacaagtattgttgttatacctgaaaccccaacacagacc
cctcctgtactgacgtcagccactgggacccaaacatctcctgcacctactactgtcacc
tttggaagtacggattcctccacgtccactcttcatactcttactccatcaacagccttg
agcacgatcgtgtcaacatcacaggttcctattcctagcacacattcctccacccttcaa
acaactccttctactccctcattgcaaacttcactcacatctacaagtgagttcactaca
gaatctttcactaggggaagtacgtctacaaatgcaatcttgacttcttttagtaccatc
atctggtcctcaacacccactattatcatgtcctcttctccatcttctgccagcataact
ccagtgttttccactaccattcattctgttccttcttcaccatacattttcagtacagaa
aatgtgggctccgcttctatcacaggctttcctagtctctcttcctctgcaactaccagc
acttcttcaaccagctcctctctgaccacagctctcactgaaataacccccttttcttat
atttcccttccctccaccacaccctgtccaggaactataacaattaccatagtccctgcc
tcccccactgatccatgtgttgaaatggatcccagcactgaagctacttctcctcccacc
accccattaacagtctttccctttactaccgaaatggtcacctgtcctacctccatcagt
atccaaactactcttactacatatatggacacttcttccatgatgccagaaagtgagtcc
agcatctcacccaatgcttccagttccactggcactgggactgtacccacaaacacagtt
ttcacaagtactcgactgcccaccagtgagacctggctgagcaacagttctgtgatcccc
ctacctcttcctggcgtctctaccatcccgctcaccatgaaaccaagcagtagcctcccg
accatcctgaggacttcaagcaagtcaacacacccctccccacccaccactaggacttca
gagacaccagtggccactacccagactcctaccacccttacatcacgcaggacaactcgc
atcacttctcagatgaccacacagtccacgttgaccaccactgcaggcacctgtgacaat
ggtggcacctgggaacagggccagtgtgcttgccttccggggttttctggggaccgctgt
cagctccagaccagatgccagaatgggggtcagtgggatggcctcaaatgccagtgcccc
agcaccttctatggttccagttgtgagtttgctgtggaacaggtggatctagatgtagtg
gagaccgaggtgggcatggaagtgtctgtggatcagcagttctcgccggacctcaatgac
aacacttcccaggcctacagggatttcaacaagaccttctggaatcagatgcagaagatt
tttgcagacatgcagggcttcaccttcaagggtgtggagatcctgtccctgaggaatggc
agcatcgtggtggactacctggtcctgctggagatgcccttcagcccccagctggagagc
gagtatgagcaggtgaagaccacgctgaaggaggggctgcagaacgccagccaggatgtg
aacagctgccaggactcccagaccctgtgttttaagcctgactccatcaaggtgaacaac
aacagcaagacagagctgaccccggcagccatctgccgccgcgccgctcccacgggctat
gaagagttctacttccccttggtggaggccacccggctccgctgtgtcaccaaatgcacg
tcgggggtggacaacgccatcgactgtcaccagggccagtgcgttctggagacgagcggt
cccacgtgtcgctgctactccaccgacacgcactggttctctggcccgcgctgcgaggtg
gccgtccactggagggcgctggtcgggggcctgacggccggcgccgcgctgctggtgctg
ctgctgctggcgctgggcgtccgggcggtgcgctccggatggtggggcggccagcgccga
ggccggtcctgggaccaggacaggaaatggttcgagacctgggatgaggaagtcgtgggc
actttttcaaactggggtttcgaggacgacggaacagacaaggatacaaatttctatgtg
gccttggagaacgtggacaccactatgaaggtgcacatcaagagacccgagatgacctcg
tcctcagtgtga

DBGET integrated database retrieval system