KEGG   Homo sapiens (human): 4585Help
Entry
4585              CDS       T01001                                 

Gene name
MUC4, ASGP, HSA276359, MUC-4
Definition
(RefSeq) mucin 4, cell surface associated
  KO
K22017  mucin-4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4585 (MUC4)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Membrane bound mucins
    4585 (MUC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD NIDO EGF
Motif
Other DBs
NCBI-GeneID: 4585
NCBI-ProteinID: NP_004523
OMIM: 158372
HGNC: 7514
Ensembl: ENSG00000145113
Vega: OTTHUMG00000151827
Pharos: Q99102(Tbio)
UniProt: Q99102 A0T3F4
Position
3q29
AA seq 1176 aa AA seqDB search
MKGARWRRVPWVSLSCLCLCLLPHVVPGMTTPSLKTDGGRRTATSPPPTTSQTIISTIPS
TAMHTRSTAAPIPILPERGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRD
SLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEY
ETFYGEHSLLVQQAESWIRKMTNNGGYKARWALKVTWVNAHAYPAQWTLGSNTYQAILST
DGSRSYALFLYQSGGMQWDVAQRSGNPVLMGFSSGDGYFENSPLMSQPVWERYRPDRFLN
SNSGLQGLQFYRLHREERPNYRLECLQWLKSQPRWPSWGWNQVSCPCSWQQGRRDLRFQP
VSIGRWGLGSRQLCSFTSWRGGVCCSYGPWGEFREGWHVQRPWQLAQELEPQSWCCRWND
KPYLCALYQQRRPHVGCATYRPPQPAWMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNS
SFLLQGRTAQTGSAQATNFIAFAAQYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPD
HEDGGGQETFNATGVLLSRNGSEVSASFDGWATVSVIALSNILHASASLPPEYQNRTEGL
LGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFY
SQLQKNSSWAEHLISNCDGDSSCIYDTLALRNASIGLHTREVSKNYEQANATLNQYPPSI
NGGRVIEAYKGQTTLIQYTSNAEDANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILA
RSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSED
ACEEPCFPSVHCVPGKGCEACPPNLTGDGRHCAALGSSFLCQNQSCPVNYCYNQGHCYIS
QTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVA
YRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAV
VEAFLYHVPRRSEEPRNDVVFQPISGEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQS
GFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGA
LGGLLLLGVGTFVVLRFWGCSGARFSYFLNSAEALP
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggcacgctggaggagggtcccctgggtgtccctgagctgcctgtgtctctgc
ctccttccgcatgtggtcccaggaatgacaacaccgtcactgaagacagacggtgggaga
cgcacagccacatcaccaccccccacaacctcccagaccatcatttccaccattcccagc
actgccatgcacacccgctccacagctgcccccatccccatcctgcctgagagaggagtt
tccctcttcccctatggggcaggcgccggggacctggagttcgtcaggaggaccgtggac
ttcacctccccactcttcaagccggcgactggcttcccccttggctcctctctccgtgat
tccctctacttcacagacaatggccagatcatcttcccagagtcagactaccagattttc
tcctaccccaacccactcccaacaggcttcacaggccgggaccctgtggccctggtggct
ccgttctgggacgatgctgacttctccactggtcgggggaccacattttatcaggaatac
gagacgttctatggtgaacacagcctgctagtccagcaggccgagtcttggattagaaag
atgacaaacaacgggggctacaaggccaggtgggccctaaaggtcacgtgggtcaatgcc
cacgcctatcctgcccagtggaccctcgggagcaacacctaccaagccatcctctccacg
gacgggagcaggtcctatgccctgtttctctaccagagcggtgggatgcagtgggacgtg
gcccagcgctcaggcaacccggtgctcatgggcttctctagtggagatggctatttcgaa
aacagcccactgatgtcccagccagtgtgggagaggtatcgccctgatagattcctgaat
tccaactcaggcctccaagggctgcagttctacaggctacaccgggaagaaaggcccaac
taccgtctcgagtgcctgcagtggctgaagagccagcctcggtggcccagctggggctgg
aaccaggtctcctgcccttgttcctggcagcagggacgacgggacttacgattccaaccc
gtcagcataggtcgctggggcctcggcagtaggcagctgtgcagcttcacctcttggcga
ggaggcgtgtgctgcagctacgggccctggggagagtttcgtgaaggctggcacgtgcag
cgtccttggcagttggcccaggaactggagccacagagctggtgctgccgctggaatgac
aagccctacctctgtgccctgtaccagcagaggcggccccacgtgggctgtgctacatac
aggcccccacagcccgcctggatgttcggggacccccacatcaccaccttggatggtgtc
agttacaccttcaatgggctgggggacttcctgctggtcggggcccaagacgggaactcc
tccttcctgcttcagggccgcaccgcccagactggctcagcccaggccaccaacttcatc
gcctttgcggctcagtaccgctccagcagcctgggccccgtcacggtccaatggctcctt
gagcctcacgacgcaatccgtgtcctgctggataaccagactgtgacatttcagcctgac
catgaagacggcggaggccaggagacgttcaacgccaccggagtcctcctgagccgcaac
ggctctgaggtctcggccagcttcgacggctgggccaccgtctcggtgatcgcgctctcc
aacatcctccacgcctccgccagcctcccgcccgagtaccagaaccgcacggaggggctc
ctgggggtctggaataacaatccagaggacgacttcaggatgcccaatggctccaccatt
cccccagggagccctgaggagatgcttttccactttggaatgacctggcagatcaacggg
acaggcctccttggcaagaggaatgaccagctgccttccaacttcacccctgttttctac
tcacaactgcaaaaaaacagctcctgggctgaacatttgatctccaactgtgacggagat
agctcatgcatctatgacaccctggccctgcgcaacgcaagcatcggacttcacacgagg
gaagtcagtaaaaactacgagcaggcgaacgccaccctcaatcagtacccgccctccatc
aatggtggtcgtgtgattgaagcctacaaggggcagaccacgctgattcagtacaccagc
aatgctgaggatgccaacttcacgctcagagacagctgcaccgacttggagctctttgag
aatgggacgttgctgtggacacccaagtcgctggagccattcactctggagattctagca
agaagtgccaagattggcttggcatctgcactccagcccaggactgtggtctgccattgc
aatgcagagagccagtgtttgtacaatcagaccagcagggtgggcaactcctccctggag
gtggctggctgcaagtgtgacgggggcaccttcggccgctactgcgagggctccgaggat
gcctgtgaggagccgtgcttcccgagtgtccactgcgttcctgggaagggctgcgaggcc
tgccctccaaacctgactggggatgggcggcactgtgcggctctggggagctctttcctg
tgtcagaaccagtcctgccctgtgaattactgctacaatcaaggccactgctacatctcc
cagactctgggctgtcagcccatgtgcacctgccccccagccttcactgacagccgctgc
ttcctggctgggaacaacttcagtccaactgtcaacctagaacttcccttaagagtcatc
cagctcttgctcagtgaagaggaaaatgcctccatggcagaagtcaacgcctcggtggca
tacagactggggaccctggacatgcgggcctttctccgcaacagccaagtggaacgaatc
gattctgcagcaccggcctcgggaagccccatccaacactggatggtcatctcggagttc
cagtaccgccctcggggcccggtcattgacttcctgaacaaccagctgctggccgcggtg
gtggaggcgttcttataccacgttccacggaggagtgaggagcccaggaacgacgtggtc
ttccagcccatctccggggaagacgtgcgcgatgtgacagccctgaacgtgagcacgctg
aaggcttacttcagatgcgatggctacaagggctacgacctggtctacagcccccagagc
ggcttcacctgcgtgtccccgtgcagtaggggctactgtgaccatggaggccagtgccag
cacctgcccagtgggccccgctgcagctgtgtgtccttctccatctacacggcctggggc
gagcactgtgagcacctgagcatgaaactcgacgcgttcttcggcatcttctttggggcc
ctgggcggcctcttgctgctgggggtcgggacgttcgtggtcctgcgcttctggggttgc
tccggggccaggttctcctatttcctgaactcagctgaggccttgccttga

DBGET integrated database retrieval system