KEGG   Homo sapiens (human): 4586Help
Entry
4586              CDS       T01001                                 

Gene name
MUC5AC, MUC5, TBM, leB, mucin
Definition
(RefSeq) mucin 5AC, oligomeric mucus/gel-forming
  KO
K21125  mucin-5AC
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4586 (MUC5AC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4586 (MUC5AC)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Secretory mucins
    4586 (MUC5AC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mucin2_WxxW VWD C8 TIL VWC TILa Pox_F12L
Motif
Other DBs
NCBI-GeneID: 4586
NCBI-ProteinID: NP_001291288
OMIM: 158373
HGNC: 7515
Ensembl: ENSG00000215182
Vega: OTTHUMG00000154270
Pharos: P98088(Tbio)
UniProt: P98088
Position
11p15.5
AA seq 5654 aa AA seqDB search
MSVGRRKLALLWALALALACTRHTGHAQDGSSESSYKHHPALSPIARGPSGVPLRGATVF
PSLRTIPVVRASNPAHNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNI
QLRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVE
ARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQK
MDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCED
TDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEH
SRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSG
GRWSCQEVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSAFTVLAELRRCGL
TDSETCLKSVTLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTS
LGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTF
KTQAACPNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFD
TCNCERSEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCPKSMTYHYHVSTCQPT
CRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYHRGSMIPNGESVHDSG
AICTCTHGKLSCIGGQAPAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCV
PGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVGCNTCTCDSRMWRCTDDPCL
ATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTC
SKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLLWDKKTSI
FINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDP
CTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVA
AYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDV
RGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCL
CTERGVECTYKAEACVCTYNGQRFHPGDVIYHTTDGTGGCISARCGANGTIERRVYPCSP
TTPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTASASLP
PVCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPGVPLR
ALGQRVQCSPDVGLTCRNREQASGLCYNYQIRVQCCTPLPCSTSSSPAQTTPPTTSKTTE
TRASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGT
SVVSSKPTPTEPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPR
SVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPICYNYEIRIQCCETVNVCRDI
TRLPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTLVT
RNCHPRCTWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEV
SIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPRGCHMTSTPGSTSSSP
AQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPA
TSTSSMSTTAPGTSVVSSKPTPTEPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQN
LRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPICYNYEIR
IQCCETVNVCRDITRPPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTA
TSVTQGTHTTPVTRNCHPRCTWTTWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEI
TRLQCRAKSHPEVSIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGC
PVTSTPVTAPSTPSGRATSPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTSTTSAP
TARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAPTTSTTSAPTSST
TSGPGTTPSPVPTTSITSAPTTSTTSAPTTSTTSARTSSTTSATTTSRISGPETTPSPVP
TTSTTSATTTSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGPGTTPSPVPTTST
TSAPTTRTTSAPKSSTTSAATTSTTSGPETTPRPVPTTSTTSSPTTSTTSAPTTSTTSAS
TTSTTSGAGTTPSPVPTTSTTSAPTTSTTSAPISSTTSATTTSTTSGPGTTPSPVPTTST
TSAPTTSTTSGPGTTPSAVPTTSITSAPTTSTNSAPISSTTSATTTSRISGPETTPSPVP
TASTTSASTTSTTSGPGTTPSPVPTTSTISVPTTSTTSASTTSTTSASTTSTTSGPGTTP
SPVPTTSTTSAPTTSTTSAPTTSTISAPTTSTTSATTTSTTSAPTPRRTSAPTTSTISAS
TTSTTSATTTSTTSATTTSTISAPTTSTTLSPTTSTTSTTITSTTSAPISSTTSTPQTST
TSAPTTSTTSGPGTTSSPVPTTSTTSAPTTSTTSAPTTRTTSVPTSSTTSTATTSTTSGP
GTTPSPVPTTSTTSAPTTRTTSAPTTSTTSAPTTSTTSAPTSSTTSATTTSTISVPTTST
TSVPGTTPSPVPTTSTISVPTTSTTSASTTSTTSGPGTTPSPVPTTSTTSAPTTSTTSAP
TTSTISAPTTSTPSAPTTSTTLAPTTSTTSAPTTSTTSTPTSSTTSSPQTSTTSASTTSI
TSGPGTTPSPVPTTSTTSAPTTSTTSAATTSTISAPTTSTTSAPTTSTTSASTASKTSGL
GTTPSPIPTTSTTSPPTTSTTSASTASKTSGPGTTPSPVPTTSTIFAPRTSTTSASTTST
TPGPGTTPSPVPTTSTASVSKTSTSHVSISKTTHSQPVTRDCHLRCTWTKWFDIDFPSPG
PHGGDKETYNNIIRSGEKICRRPEEITRLQCRAESHPEVSIEHLGQVVQCSREEGLVCRN
QDQQGPFKMCLNYEVRVLCCETPKGCPVTSTPVTAPSTPSGRATSPTQSTSSWQKSRTTT
LVTTSTTSTPQTSTTSAPTTSTTSAPTTSTTSAPTTSTTSTPQTSISSAPTSSTTSAPTS
STISARTTSIISAPTTSTTSSPTTSTTSATTTSTTSAPTSSTTSTPQTSKTSAATSSTTS
GSGTTPSPVTTTSTASVSKTSTSHVSVSKTTHSQPVTRDCHPRCTWTKWFDVDFPSPGPH
GGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLVCRNQD
QQGPFKMCLNYEVRVLCCETPKGCPVTSTSVTAPSTPSGRATSPTQSTSSWQKSRTTTLV
TSSITSTTQTSTTSAPTTSTTPASIPSTTSAPTTSTTSAPTTSTTSAPTTSTTSTPQTTT
SSAPTSSTTSAPTTSTISAPTTSTISAPTTSTTSAPTASTTSAPTSTSSAPTTNTTSAPT
TSTTSAPITSTISAPTTSTTSTPQTSTISSPTTSTTSTPQTSTTSSPTTSTTSAPTTSTT
SAPTTSTTSTPQTSISSAPTSSTTSAPTASTISAPTTSTTSFHTTSTTSPPTSSTSSTPQ
TSKTSAATSSTTSGSGTTPSPVPTTSTASVSKTSTSHVSVSKTTHSQPVTRDCHPRCTWT
KWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAESHPEVSIEHLGQVVQ
CSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPKGCPVTSTPVTAPSTPSGRATSPTQS
TSSWQKSRTTTLVTTSTTSTPQTSTTSAPTTSTIPASTPSTTSAPTTSTTSAPTTSTTSA
PTHRTTSGPTTSTTLAPTTSTTSAPTTSTNSAPTTSTISASTTSTISAPTTSTISSPTSS
TTSTPQTSKTSAATSSTTSGSGTTPSPVPTTSTTSASTTSTTSAPTTSTTSGPGTTPSPV
PSTSTTSAATTSTTSAPTTRTTSAPTSSMTSGPGTTPSPVPTTSTTSAPTTSTTSGPGTT
PSPVPTTSTTSAPITSTTSGPGSTPSPVPTTSTTSAPTTSTTSASTASTTSGPGTTPSPV
PTTSTTSAPTTRTTSASTASTTSGPGSTPSPVPTTSTTSAPTTRTTPASTASTTSGPGTT
PSPVPTTSTTSASTTSTISLPTTSTTSAPITSMTSGPGTTPSPVPTTSTTSAPTTSTTSA
STASTTSGPGTTPSPVPTTSTTSAPTTSTTSASTASTTSGPGTSLSPVPTTSTTSAPTTS
TTSGPGTTPSPVPTTSTTSAPTTSTTSGPGTTPSPVPTTSTTPVSKTSTSHLSVSKTTHS
QPVTSDCHPLCAWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAES
HPEVNIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSVTPYG
TSPTNALYPSLSTSMVSASVASTSVASSSVASSSVAYSTQTCFCNVADRLYPAGSTIYRH
RDLAGHCYYALCSQDCQVVRGVDSDCPSTTLPPAPATSPSISTSEPVTELGCPNAVPPRK
KGETWATPNCSEATCEGNNVISLRPRTCPRVEKPTCANGYPAVKVADQDGCCHHYQCQCV
CSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSII
LEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATIPELGVQVM
FSGLIFSVEVPFSKFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQP
ACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHT
VIPPLLFYEGCVFDRCHMTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADK
VYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLG
PHGEPVKVGHTVGMDCQECTCEAATWTLTCRPKLCPLPPACPLPGFVPVPAAPQAGQCCP
QYSCACNTSRCPAPVGCPEGARAIPTYQEGACCPVQNCSWTVCSINGTLYQPGAVVSSSL
CETCRCELPGGPPSDAFVVSCETQICNTHCPVGFEYQEQSGQCCGTCVQVACVTNTSKSP
AHLFYPGETWSDAGNHCVTHQCEKHQDGLVVVTTKKACPPLSCSLDEARMSKDGCCRFCP
PPPPPYQNQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQ
CCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQHSEEAEPEPSQEAE
SGSWERGVPVSPMH
NT seq 16965 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttggccggaggaagctggccctgctctgggccctggctctcgctctggcctgc
acccggcatacaggccatgcccaggatggctcctccgaatccagctacaagcaccaccct
gccctctctcctatcgcccgggggcccagcggggtcccgctccgtggggcgactgtcttc
ccatctctgaggaccatccctgtggtacgagcctccaacccggcgcacaacgggcgggtg
tgcagcacctggggcagcttccactacaagaccttcgacggcgacgtcttccgcttcccc
ggcctctgcaactacgtgttctccgagcactgcggtgccgcctacgaggattttaacatc
cagctacgccgcagccaggagtcagcggcccccacgctgagcagggtcctcatgaaggtg
gatggcgtggtcatccagctgaccaagggctccgtcctggtcaacggccacccggtcctg
ctgcccttcagccagtctggggtcctcattcagcagagcagcagctacaccaaggtggag
gccaggctgggccttgtcctcatgtggaaccacgatgacagcctgctgctggagctggac
accaaatacgccaacaagacctgtgggctctgtggggacttcaacgggatgcccgtggtc
agcgagctcctctcccacaacaccaagctgacacccatggaattcgggaacctgcagaag
atggacgaccccacggaccagtgtcaggaccctgtccctgaacccccgaggaactgctcc
actggctttggcatctgtgaggagctcctgcacggccagctgttctctggctgcgtggcc
ctggtggacgtcggcagctacctggaggcttgcaggcaagacctctgcttctgtgaagac
accgacctgctcagctgcgtctgccacacccttgccgagtactcccggcagtgcacccat
gcaggggggttgccccaggactggcggggccctgacttctgcccccagaagtgccccaac
aacatgcagtaccacgagtgccgctccccctgcgcagacacctgctccaaccaggagcac
tcccgggcctgtgaggaccactgtgtggccggctgcttctgccctgaggggacggtgctt
gacgacatcggccagaccggctgtgtccctgtgtcaaagtgtgcctgcgtctacaacggg
gctgcctatgccccaggggccacctactccacagactgcaccaactgcacctgctccgga
ggccggtggagctgccaggaggttccatgcccgggtacctgctctgtgcttggaggtgcc
cacttctcaacgtttgacgggaagcaatacacggtgcacggcgactgcagctatgtgctg
accaagccctgtgacagcagtgccttcactgtactggctgagctgcgcaggtgcgggctg
acggacagcgagacctgcctgaagagcgtgacactgagcctggatggggcgcagacggtg
gtggtgatcaaggccagtggggaagtgttcctgaaccagatctacacccagctgcccatc
tctgcagccaacgtcaccatcttcagaccctcaaccttcttcatcatcgcccagaccagc
ctgggcctgcagctgaacctgcagctggtgcccaccatgcagctgttcatgcagctggcg
cccaagctccgtgggcagacctgcggtctctgtgggaacttcaacagcatccaggccgat
gacttccggaccctcagtggggtggtggaggccaccgctgcggccttcttcaacaccttc
aagacccaggccgcctgccccaacatcaggaacagcttcgaggacccctgctctctgagc
gtggagaatgagaagtatgctcagcactggtgctcgcagctgaccgatgccgacggcccc
ttcggccggtgccatgctgccgtgaagccgggaacctactactcgaactgcatgtttgac
acctgcaactgtgagcggagcgaggactgcctgtgcgccgcgctgtcctcctacgtgcac
gcctgtgccgccaagggcgtgcagctcggcggctggagggacggcgtctgcacgaagcct
atgaccacttgccccaagtcaatgacgtaccactaccatgtcagcacctgccagcccacc
tgccgctccctgagcgagggggacatcacctgcagtgttggcttcatccccgtggatggc
tgcatctgtcccaagggcaccttcctggacgacacgggcaagtgtgtgcaggccagcaac
tgtccctgctaccacagaggctccatgatccccaatggggagtcggtgcacgacagcggg
gctatctgcacctgcacacatgggaagctgagctgcatcggaggccaagcccccgcccca
gtgtgtgctgcgcccatggtgttctttgactgccgaaatgccacgcccggggacacaggg
gctggctgtcagaagagctgccacacactggacatgacctgttacagcccccagtgtgtg
cctggctgcgtgtgccccgacgggctggtggcggacggcgagggcggctgcatcactgcg
gaggactgcccctgcgtgcacaatgaggccagctaccgggccggccagaccatccgggtg
ggctgcaacacctgcacctgtgacagcaggatgtggcggtgcacagatgacccctgcctg
gccacctgcgccgtgtacggggacggccactacctcaccttcgacggacagagctacagc
ttcaacggagactgcgagtacacgctggtgcagaaccactgtggcgggaaagacagcacc
caggactcctttcgtgttgtcaccgagaacgtcccctgcggcaccacagggaccacctgc
tccaaggccatcaagattttcctggggggcttcgagctgaagctaagccatgggaaggtg
gaggtgatcgggacggacgagagccaggaggtgccatacaccatccggcagatgggcatc
tacctggtggtggacaccgacattggcctggtgctgctgtgggacaagaagaccagcatc
ttcatcaacctcagccccgagttcaagggcagggtctgcggcctgtgtgggaacttcgac
gacatcgccgttaatgactttgccacgcggagccggtctgtggtgggggacgtgctggag
tttgggaacagctggaagctctccccctcctgcccagatgccctggcgcccaaggacccc
tgcacggccaaccccttccgcaagtcctgggcccagaagcagtgcagcatcctccacggc
cccaccttcgccgcctgccacgcacacgtggagccggccaggtactacgaggcctgcgtg
aacgacgcgtgcgcctgcgactccgggggtgactgcgagtgcttctgcacggctgtggcc
gcctacgcccaggcctgccatgaagtaggcctgtgtgtgtcctggcggaccccgagcatc
tgccctctgttctgcgactactacaaccccgaaggccagtgcgagtggcactaccagccc
tgcggggtgccctgcctgcgcacctgccggaacccccgtggagactgcctgcgggacgtc
cggggcctggaaggctgctaccccaagtgcccaccagaggctcccatctttgatgaggac
aagatgcagtgtgtggccacctgcccaaccccgcctctgccaccacggtgccacgtccat
gggaagtcctaccggccaggtgcagtggtgccctcggacaagaactgccagtcctgcctt
tgtacggagcgcggcgtggagtgcacctacaaagctgaggcctgtgtctgcacctacaat
ggacagcgcttccacccaggggacgtcatctaccacacgacggatggcacgggtggctgc
atctccgcccgctgcggggccaacggcaccattgagaggagggtctacccctgcagcccc
accacccctgtccccccaaccaccttctccttctccacacccccgcttgtcgtgagctcc
acgcacacccccagcaatggcccaagcagcgcgcacacaggccctccgagcagcgcctgg
cccaccacagcaggcacttctcccaggacgaggctgcccacagcctctgcctcactgccg
ccggtctgtggggaaaagtgcctgtggtcgccatggatggatgtcagccgccctggacgg
ggcacggacagcggtgacttcgacacactggagaacctccgcgcccatgggtaccgggtg
tgcgaatcacccaggtcggtggagtgccgagctgaggacgcccccggagtgccgctccga
gccctggggcagcgtgtgcagtgcagcccggatgtggggctgacctgtcgtaacagggag
caggcatcggggctctgctacaactaccagatcagggtccagtgctgcacgcccctaccc
tgctccacctctagcagtccagcccagaccactcctccaactacctccaagaccactgaa
acccgggcctcaggctcctcagctcccagcagcacacctggcaccgtgtctctctctaca
gccaggacgacacctgccccaggtaccgctacctctgtcaaaaaaactttctcaactccc
agccctccgccagtgccggcaacatcaacatcatccatgtcgaccacggccccggggacc
tctgtggtctccagcaagcccacccccacggagcccagcacatcctcctgcctgcaggag
ctttgcacctggaccgagtggatcgatggcagctaccctgctcctggaataaatggtgga
gattttgacacatttcaaaatttgagagacgaaggatacacattctgtgaaagtcctcga
agcgtgcagtgccgggcagagagcttccccaacacgccgctggcagacctggggcaggac
gtcatctgcagccacacagaggggctgatttgcctgaacaagaaccagctcccacccatc
tgctacaactatgagatccgcatccagtgttgcgagacggtgaacgtgtgcagagacatc
accagactgccaaagaccgtcgcaacgacacggccgactccacatccaaccggagctcag
acccagaccaccttcaccacacacatgccctcggcctccacagagcaacccacggcaacc
tccaggggtgggcccacagcaaccagcgtcacacagggcacccacaccacactagtcacc
agaaactgtcatccccggtgcacctggacaaagtggttcgacgtggacttcccgtccccc
ggaccccatggtggagacaaggaaacctacaacaacatcatcaggagtggggaaaaaatc
tgccgccgacctgaggagatcaccaggctccagtgccgagccaagagccacccagaggtg
agcatcgaacacctgggccaggtggtgcagtgcagccgggaagagggcctggtgtgccgg
aaccaggaccagcagggacccttcaagatgtgcctcaactacgaggtgcgtgtgctctgc
tgcgagacccccagaggctgccacatgacctccacacctggctccacctctagcagtcca
gcccagaccactccttcaacaacctccaagaccactgaaacccaggcctcaggctcctca
gcccccagcagcacacctggcaccgtgtctctctctacagccaggacgacacctgcccca
ggtaccgctacctctgtcaaaaaaactttctcaactcccagccctccgccagtgccggca
acatcaacatcatccatgtcgaccacggccccggggacctctgtggtctccagcaagccc
acccccacggagcccagcacatcctcctgcctgcaggagctttgcacctggaccgagtgg
attgatggcagctaccctgctcctggaataaatggtggagattttgacacatttcaaaat
ttgagagacgaaggatacacattctgtgaaagtcctcgaagcgtgcagtgccgggcagag
agcttccccaacacgccgctggcagacctggggcaggacgtcatctgcagccacacagag
gggctgatttgcctgaacaagaaccagctcccacccatctgctacaactatgagatccgc
atccagtgttgcgagacggtgaacgtgtgcagagacatcaccagaccgccaaagaccgtc
gcaacgacacggccgactccacatccaaccggagctcagacccagaccaccttcaccaca
cacatgccctcggcctccacagagcaacccacggcaacctccaggggtgggcccacagca
accagcgtcacacagggcacccacaccacaccagtcaccagaaactgtcatccccggtgc
acctggacaacgtggttcgacgtggacttcccgtcccccggaccccatggtggagacaag
gaaacctacaacaacatcatcaggagtggggaaaaaatctgccgccgacctgaggagatc
accaggctccagtgccgagccaagagccacccagaggtgagcatcgaacacctgggccag
gtggtgcagtgcagccgggaagagggcctggtgtgccggaaccaggaccagcagggaccc
ttcaagatgtgcctcaactacgaggtgcgtgtgctctgctgcgagacccccaaaggctgc
cccgtgacctccacacctgtgacagctcctagcacccctagtgggagagccaccagccca
actcagagcacctcctcttggcagaaatccaggacaaccactttggtgacaaccagcaca
acctccactccacagaccagtacaacctatgcccatacaaccagcacaacctctgctcct
acagccagaacaacctctgctcctacaaccagaacaacctctgcctctccagccagcaca
acctctggtcctggaaatactcccagccctgttcctaccaccagcacaatctctgctcct
acaactagcataacctctgcccctacaaccagcacaacctctgcccctacaagcagcaca
acctctggtcctggaactactcccagccctgttcctaccaccagcataacctctgcccct
acaaccagcacaacctctgctcctacaaccagcacaacctctgcccgtacaagcagcaca
acctctgccactaccaccagcagaatctctggtcctgaaactactcccagccctgttcct
accaccagcacaacctctgccactacaaccagcacaacctcagctcctacaaccagcaca
acctctgcccctacaagcagcacaacctccagtccacagaccagcacaacctcggctcct
acaaccagcacaacttctggtcctggaactaccccaagccctgttcccacgaccagcaca
acctctgcccctacaacaagaacaacttctgctcctaaaagcagcacaacctctgccgct
acaaccagcacaacctctggtcctgaaactactcctagacctgttcctaccaccagcaca
acctcttctcctacaaccagcacaacctctgctcctacaaccagcacaacctctgcttct
acaaccagcacaacctctggtgctggaactactcccagccctgttcccaccaccagcaca
acctctgctcctacaaccagcacaacctctgcccctataagcagcacaacctctgccact
acaaccagcacaacctctggtcctggaactactcccagccctgttcctaccacgagcaca
acctctgctcctacaaccagcacaacctctggtcctggaactactcccagtgctgttccc
accaccagcataacctctgcacctacaaccagcacaaactctgcccctataagcagcaca
acctctgccactacaaccagcagaatctctggtcctgaaactactcccagccctgttcct
accgccagcacaacctctgcttctacaactagcacaacctctggtcctggaactactccc
agccctgttcctaccaccagcacaatctctgttcctaccaccagcacaacttctgcttct
acaaccagcacaacctctgcttctacaaccagcacaacctctggtcctggaactactccc
agccctgttcccaccaccagcacaacctctgctcccacaacaagcacaacctctgcccct
acaaccagcacaatctcggccccaacaaccagcacaacctctgccactacaaccagcacg
acctctgctcctacacccagaagaacctcagcccctacaaccagcacaatctctgcctct
accaccagcacaacctctgcgactacaaccagcacaacctctgctactacaaccagcaca
atctctgcccctacaaccagcacaactttgtctcctacaaccagcacaacctctactact
ataaccagcacaacttctgcccctataagcagcacaacttccacaccacagaccagcaca
acttcggctcctacaaccagcacaacttctggtcctggaactacttcaagccctgttccc
accaccagcacaacctctgcccctacaaccagcacaacctctgcccctacaaccagaaca
acctctgtccctacaagcagcacaacctccactgctacaaccagcacaacctctggccct
ggaactactcccagccctgttcccaccaccagtacaacctctgctcctacaaccagaaca
acctctgctcctacaaccagcacaacctctgcccctacaaccagcacaacctctgcccct
acaagcagcacaacctcagctactacaaccagcacaatctctgttcctacaaccagcaca
acttctgttcctggaactactcccagccctgttcctaccaccagcacaatctctgttcct
accaccagcacaacttctgcttctacaaccagcacaacctctggtcctggaactactccc
agccctgttcccaccaccagcacaacctctgctcccacaacaagcacaacctctgcccct
acaaccagcacaatctcggccccaacaaccagcacaccctctgcccctacaaccagcaca
accttagctcctacaaccagcacaacctctgcccctacaaccagcacaacctctacccct
acaagcagcacaacctcctctccacagaccagcacaacctcggcttctaccaccagcata
acttctggtcctggaactaccccaagccctgttcccaccaccagcacaacctctgctcct
acaaccagcacaacctctgccgctacaaccagcacaatctcggccccaacaaccagcaca
acgtctgctcctacaaccagcacaacctctgcctctacagccagcaaaacctctggtctt
ggaactactcccagccctattcctaccaccagcacaacctctcctcctacaaccagcaca
acttctgcctctacagccagcaaaacctctggtcctggaaccactcccagccctgttccc
accaccagcacaatctttgctcctagaaccagcaccacttctgcctctacaaccagcaca
acccctggtcctggaaccactcccagccccgttcccaccaccagcacagcctctgtttca
aagaccagcacaagccatgtttccatatccaagacaacccactcccaaccagtcaccaga
gactgtcatctccggtgcacctggaccaagtggtttgacatagacttcccatcccctgga
ccccacggcggggacaaggaaacctacaacaacatcatcaggagtggggaaaaaatctgc
cgccgacctgaggagatcaccaggctccagtgccgagccgagagccacccggaggtgagc
attgaacacctgggccaggtggtgcagtgcagccgtgaagagggcctggtgtgccggaac
caggaccagcagggacccttcaagatgtgcctcaactacgaggtgcgtgtgctctgctgc
gagacccctaaaggttgccccgtgacctccacacctgtgacagctcctagcacccctagt
gggagagccaccagcccaactcagagcacttcctcttggcagaaatccaggacaaccact
ttggtgacaaccagcacaacctccactccacagaccagcacaacctctgctcctacaacc
agcacaacctctgctcccacaaccagcacaacttctgcccctacaaccagcacaacctcc
actccacagaccagcatatcctctgcccctacaagcagcacaacctcggctcctacaagc
agcacaatctctgctcgtacaaccagcataatctctgcccctacaaccagcacaacctct
tcccctacaaccagcacaacctctgctactacaaccagcacaacctctgcccctacaagc
agcacaacctccactccacagaccagcaaaacctcagctgctacaagcagcacaacctcc
ggttctggaactactcccagccctgttaccaccaccagcacagcctctgtttcaaagacc
agcacaagccatgtttctgtatccaagacaacccactcccaaccagtcaccagagactgt
catccccggtgcacctggaccaaatggtttgatgtggactttccatcccctggaccccac
ggtggggacaaggaaacctacaacaacatcatcaggagtggggaaaaaatctgccgccga
cctgaggagatcaccaggctccagtgccgagccaagagccacccggaggtgagcatcgaa
cacctgggccaggtggtgcagtgcagccgcgaagagggcctggtgtgccggaaccaggac
cagcagggacccttcaagatgtgcctcaactacgaggtgcgtgtgctttgctgcgagacc
cccaaaggctgccccgtgacctccacatctgtgacagctcctagcacccctagtgggaga
gccaccagcccaactcagagcacctcctcttggcagaaatccaggacaaccactttggtg
acaagcagcataacctccactacacagaccagcacaacctctgcccctacaactagcaca
acccctgcttctatacccagcacaacctctgccccaacaaccagcacaacctctgctccc
acaacgagcacaacttctgcccctacaaccagcacaacctccactccacagaccaccaca
tcctctgcccctacaagcagcacaacctcggctcctaccaccagcacaatctctgcccct
acaaccagcacaatctctgcccctacaaccagcacaacctctgctcccacagccagcaca
acgtcagctcctacgagcacttcctcggctcctacaaccaacacaacctctgcccctaca
actagcactacctctgctcccataaccagcacaatctctgcccctacaaccagcacaacc
tccactccacagaccagcacaatctcttcccctacaaccagcacaacctccactccgcag
accagcacaacctcttcccctacaactagcacaacctcagctcctacaaccagcacaact
tctgcccctacaaccagcacaacctccactccacagaccagcatatcctctgcccctaca
agcagcacaacctctgctcctacagccagcacaatctctgcccctacaaccagcacaacc
tctttccatacaaccagcacaacctctccccctacaagcagcacaagctccactccacag
accagcaaaacctcagctgctacaagcagcacaacctccggttctggaactactcccagc
cccgttcccaccaccagcacagcctctgtttcaaagaccagcacaagccatgtttctgta
tccaagacaacccactcccaaccagtcaccagagactgtcatccccggtgcacctggacc
aagtggtttgacgtggactttccatcccctggaccccacggtggggacaaggaaacctac
aacaacatcatcaggagtggggaaaaaatctgccgccgacctgaggagatcaccaggctc
cagtgccgagccgagagccacccggaggtgagcatcgaacacctgggccaggtggtgcag
tgcagccgggaagagggcctggtgtgccggaaccaggaccagcagggacccttcaagatg
tgcctcaactacgaggtgcgtgtgctctgctgcgagacccccaaaggctgccccgtgacc
tccacacctgtgacagctcctagcacccctagtgggagagccaccagcccaactcagagc
acttcctcttggcagaaatccaggacaaccactttggtgacaaccagcacaacctccact
ccacagaccagcacaacctctgcccctacaaccagcacaatccctgcttctacacccagc
acaacctctgcccctacaaccagcacaacctctgcccctacaaccagcacgacctcagct
cctacacacagaacgacttctggtcctacaaccagcacaaccttggctcctacaaccagc
acaacctctgctccaacaaccagcacaaactctgctcctacaaccagcacaatctctgcc
tctacaaccagcacaatctctgcccctacaaccagcacaatctcttcccctacaagcagc
acaacctccactccacagaccagcaaaacctcagctgctacaagcagcacaacctccggt
tctggaactactccaagccctgttcccaccaccagcacaacctctgcctctacaaccagc
acaacttctgctcctacaaccagcacaacctctggtcctggaactactccaagccctgtt
cccagcaccagtacaacctctgctgctacaaccagcacaacctctgctcctacaaccaga
acaacatctgctcctacaagcagcatgacctctggtcctggaactactcccagccctgtt
cccaccaccagcacaacctctgctcctacaactagcacaacctctggtcctggaactact
cccagccctgttcccaccaccagcacaacctctgctcctataaccagcacaacctctggt
cctggaagtactcccagccctgttcccaccaccagcacaacctctgctcctacaaccagc
acaacctctgcctctacagccagcacaacctctggtcctggaactactcccagccctgtt
cccaccaccagcacaacctctgctcctacaaccagaacaacctctgcctctacagccagc
acaacctctggtcctggaagtactcccagccctgttcccaccaccagcacaacctctgct
cctacaaccagaacaacccctgcctctacagccagcacaacctctggtcctggaactact
cccagccctgttcccaccacaagcacaacctctgcttctacaaccagcacaatctctctc
cctacaaccagcacaacctctgctcctataaccagcatgacctctggtcctggaactact
cccagccctgttcccaccaccagcacaacctctgctcctacaaccagcacaacctctgcc
tctacagccagcacaacctctggtcctggaactactcccagccctgttcccaccaccagc
acaacctctgctcctacaaccagcacaacctctgcctctacagccagcacaacctctggt
cctggaacttctctcagccctgttcccaccacgagcacaacctctgctcctacaactagc
acaacctctggtcctggaactactcccagccctgttcccaccaccagcacaacctctgct
cctacaaccagcacgacctctggtcctggaactactcccagccccgttcccaccaccagc
acaacccctgtttcaaagaccagcacaagccatctttctgtatccaagacaacccactcc
caaccagtcaccagtgactgtcatcctctgtgcgcctggacaaagtggttcgacgtggac
ttcccatcccctggaccccacggcggggacaaggaaacctacaacaacatcatcaggagt
ggggaaaaaatctgccgccgacctgaggagatcaccaggctccagtgccgagccgagagc
cacccggaggtgaacattgaacacctgggtcaggtggtgcagtgcagccgtgaagagggc
ctggtgtgccggaaccaggaccagcagggacccttcaagatgtgcctcaactacgaggtg
cgcgtgctctgctgcgagacccccagaggctgcccggtgacctctgtgaccccatatggg
acttctcctaccaatgctctgtatccttccctgtctacttccatggtatccgcctccgtg
gcatccacctctgtggcatccagctctgtggcatccagctctgtggcttactccacccaa
acctgcttctgcaacgtggctgaccggctctaccctgcaggatccaccatataccgccac
agagacctcgctggccattgctattatgccctgtgtagccaggactgccaagtggtcaga
ggggttgacagtgactgtccgtccaccacgctgcctcctgccccagccacgtccccttca
atatccacctccgagcccgtcactgagctgggatgcccaaatgcggttccccccagaaag
aaaggtgagacctgggccacacccaactgctccgaggccacctgtgagggcaacaacgtc
atctccctgcgcccgcgcacgtgcccgagggtggagaagcccacttgtgccaacggctac
ccggctgtgaaggtggctgaccaagatggctgctgccatcactaccagtgccagtgtgtg
tgcagcggctggggtgacccccactacatcaccttcgacggcacctactacaccttcctg
gacaactgcacgtacgtgctggtgcagcagattgtgcccgtgtatggccacttccgcgtg
ctcgtcgacaactacttctgcggtgcggaggacgggctctcctgcccgaggtccatcatc
ctggagtaccaccaggaccgcgtggtgctgacccgcaagccagtccacggggtgatgaca
aacgagatcatcttcaacaacaaggtggtcagccccggcttccggaaaaacggcatcgtg
gtctcgcgcatcggcgtcaagatgtacgcgaccatcccggagctgggagtccaggtcatg
ttctccggcctcatcttctccgtggaggtgcccttcagcaagtttgccaacaacaccgag
ggccagtgcggcacttgcaccaacgacaggaaggatgagtgccgcacgcctagggggacg
gtggtcgcttcctgctccgagatgtccggcctctggaacgtgagcatacccgaccagcca
gcctgccaccggcctcacccgacgcccaccacggtcgggcccaccacagttgggtctacc
acggtcgggcccaccacagttgggtctaccacggtcgggcccaccacaccgcctgctccg
tgcctgccatcacccatctgccagctgattctgagcaaggtctttgagccgtgccacact
gtgatccccccactgctgttctatgagggctgcgtctttgaccggtgccacatgacggac
ctggatgtggtgtgctccagcctggagctgtacgcggcactctgtgcgtcccacgacatc
tgcatcgattggagaggccggaccggccacatgtgcccattcacctgcccagccgacaag
gtgtaccagccctgcggcccgagcaacccctcctactgctacgggaatgacagcgccagc
ctcggggctctgccggaggccggccccatcaccgaaggctgcttctgtccggagggcatg
accctcttcagcaccagtgcccaagtctgcgtgcccacgggctgccccaggtgtctgggg
ccccacggagagccggtgaaggtgggccacaccgtcggcatggactgccaggagtgcacg
tgtgaggcggccacgtggacgctgacctgccgacccaagctctgcccgctgccccctgcc
tgccccctgcccggcttcgtgcctgtgcctgcagccccacaggccggccagtgctgcccc
cagtacagctgcgcctgcaacaccagccgctgccccgcgcccgtgggctgtcctgagggc
gcccgcgcgatcccgacctaccaggagggggcctgctgcccagtccaaaactgcagctgg
acagtgtgcagcatcaacgggaccctgtaccagcccggcgccgtggtctcctcgagcctg
tgcgaaacctgcaggtgtgagctgccgggtggccccccatcggacgcgtttgtggtcagc
tgtgagacccagatctgcaacacacactgccctgtgggcttcgagtaccaggagcagagc
gggcagtgctgtggcacctgtgtgcaggtcgcctgtgtcaccaacaccagcaagagcccc
gcccacctcttctaccccggcgagacctggtcagacgcagggaaccactgtgtgacccac
cagtgtgagaagcaccaggatgggctcgtggtggtcaccacgaagaaggcgtgccccccg
ctcagctgttctctggacgaggcccgcatgagcaaggacggctgctgccgcttctgcccg
ccgcccccgcccccgtaccagaaccagtcgacctgtgctgtgtaccataggagcctgatc
atccagcagcagggctgcagctcctcggagcccgtgcgcctggcttactgccgggggaac
tgtggggacagctcttccatgtactcgctcgagggcaacacggtggagcacaggtgccag
tgctgccaggagctgcggacctcgctgaggaatgtgaccctgcactgcaccgacggctcc
agccgggccttcagctacaccgaggtggaagagtgcggctgcatgggccggcggtgccct
gcgccgggcgacacccagcactcggaggaggcggaacccgagcccagccaggaggcagag
agtgggagctgggagagaggcgtcccagtgtcccccatgcactga

DBGET integrated database retrieval system