KEGG   Homo sapiens (human): 4588Help
Entry
4588              CDS       T01001                                 

Gene name
MUC6, MUC-6
Definition
(RefSeq) mucin 6, oligomeric mucus/gel-forming
  KO
K22023  mucin-6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4588 (MUC6)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Secretory mucins
    4588 (MUC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD C8 TIL VWC
Motif
Other DBs
NCBI-GeneID: 4588
NCBI-ProteinID: NP_005952
OMIM: 158374
HGNC: 7517
Ensembl: ENSG00000184956
Vega: OTTHUMG00000165140
Pharos: Q6W4X9(Tbio)
UniProt: Q6W4X9
Position
11p15.5
AA seq 2439 aa AA seqDB search
MVQRWLLLSCCGALLSAGLANTSYTSPGLQRLKDSPQTAPDKGQCSTWGAGHFSTFDHHV
YDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEAIISVKDIGV
ISLPYTSNGLQITPFGQSVRLVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFD
GKVTNEFVSEEGKFLEPHKFAALQKLDDPGEICTFQDIPSTHVRQAQHARICTQLLTLVA
PECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWRSPGLCSVG
QCPANQVYQECGSACVKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCV
LHGAMYAPGEVTIAACQTCRCTLGRWVCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT
YILLQSPQLPEDGALMAVYDKSGVSHSETSLVAVVYLSRQDKIVISQDEVVTNNGEAKWL
PYKTRNITVFRQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDT
TDDFTTSMGIAEGTASLFVDSWRAGNCPAALERETDPCSMSQLNKVCAETHCSMLLRTGT
VFERCHATVNPAPFYKRCVYQACNYEETFPHICAALGDYVHACSLRGVLLWGWRSSVDNC
TIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQ
CPCILEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENK
FGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGVSYPGGA
ELHTDCRTCSCSRGRWACQQGTHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCG
VNDSQPTFKILTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLGVTPG
ALSLVVDISIPGRYNLTLIWNRHMTILIRIARASQDPLCGLCGNFNGNMKDDFETRSRYV
ASSELELVNSWKESPLCGDVSFVTDPCSLNAFRRSWAERKCSVINSQTFATCHSKVYHLP
YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWRTPAFCPIYCGFYNTHTQD
GHGEYQYTQEANCTWHYQPCLCPSQPQSVPGSNIEGCYNCSQDEYFDHEEGVCVPCMPPT
TPQPPTTPQLPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLT
SSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTST
AQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQP
TRPTATETTQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFHATTTYPTPSHPE
TTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPTTLKATGSTHTAP
PITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTPTSTTTITPNPTSTRTRTPVAH
TNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQTTLPTHVPPFS
TSLVTPSTHTVITPTHAQMATSASIHSMPTGTIPPPTTLKATGSTHTAPTMTLTTSGTSQ
ALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSF
STAKTSTSLHSHTSSTHHPEVTSTSTTSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTH
SPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTTLPTHVPSFSTSLVTPSTHTVIIPTH
TQMATSASIHSMPTGTIPPPTTIKATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPY
HTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAHTTSASSSRLPTPFTTHSPPTGSSPFSS
TGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIITTHTQMATSASIHS
TPTGTVPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSS
RPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVG
TSSSFVSAPVHSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPF
TLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRV
PTSGFVSLTSGVTGIPTSPVTNLTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGT
PTPTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAASFNIITQQVDARCSCCRPLH
SYEQQLELPCPDPSTPGRRLVLTLQVFSHCVCSSVACGD
NT seq 7320 nt NT seq  +upstreamnt  +downstreamnt
atggtccagcggtggctgctgctgtcctgctgcggagccctgctcagcgctggtctggct
aacacctcctacaccagcccaggcctccagaggctgaaggactctccacagacagccccg
gacaaaggccagtgctccacgtggggggctggtcacttctccaccttcgaccaccacgtg
tacgacttctcggggacgtgcaactacatcttcgcggccacctgcaaggacgccttcccc
accttcagtgtccagctgcggcgaggcccagacgggagcatctcgcggatcatcgtggag
ctgggggcctccgtcgtcactgtgagcgaagccatcatctcagtcaaggacatcggggtc
atcagcctgccctataccagcaatggactccagatcacacccttcggccagagcgtgcgg
ctggtggccaagcagctggagctggagctggaagtcgtgtggggtcctgacagccacctc
atggttctggtggagcggaagtacatgggtcagatgtgcgggctctgcgggaactttgac
gggaaggtgaccaacgagtttgtcagtgaggagggcaagttcctggaaccccacaagttt
gctgccctccagaagctggacgaccccggcgagatctgcaccttccaggacatccccagc
acccacgtccggcaggcccagcacgcccggatctgcacccagctgctgaccctggtggcc
cctgagtgcagcgtgtccaaggagcccttcgtgctaagctgccaggcggacgtggccgca
gccccccagccaggcccacagaacagcagttgtgccaccctgtcggagtactcccgccag
tgcagcatggtgggccagccggtccgccgctggcggagccccggcctgtgctccgtgggt
cagtgcccggccaaccaggtgtaccaggagtgcggctcggcctgcgtgaagacctgctcc
aacccgcagcacagctgctccagctcctgcaccttcgggtgcttctgcccggaaggtacg
gtcctgaatgacctctccaataaccacacctgcgtgcccgtcacccagtgcccctgtgtg
ctccacggcgccatgtatgcccccggggaggtcacaatagctgcctgccaaacctgccgg
tgcaccctgggccgctgggtgtgcacggagcggccgtgccccggacactgctccctggaa
ggtggctcctttgttaccacatttgacgccaggccctaccgcttccacggcacctgcacc
tacatcctcctccagagcccccagcttcccgaggacggtgccctcatggctgtgtacgac
aagtccggcgtctcacactccgagacctccctggtggctgtggtctacctctccaggcag
gacaaaattgtgatctctcaggacgaggtggtcaccaacaacggagaagccaagtggctg
ccatacaagactcgcaacatcacggtcttcaggcagacgtccacccacctccagatggcc
accagcttcgggctggagctcgtggtccagctgcgccccatcttccaggcctatgtcact
gttgggccccagttcagaggtcagaccagagggctctgcggcaacttcaacggggacaca
acggatgacttcaccactagcatgggtatcgccgagggcaccgcctcgctgtttgtggac
tcctggcgggcggggaactgtccggccgctctggagcgtgagactgacccctgctccatg
agccagctcaacaaggtgtgtgcagagacccactgctccatgctgctgaggacaggcacg
gtgttcgagaggtgccacgccacagtgaaccctgcacccttctacaagaggtgcgtgtac
caggcctgcaactacgaggagacctttccccacatctgtgccgccctgggcgactacgta
cacgcctgctccttgcggggcgtcctgctctggggctggagaagcagtgtggacaactgc
accatcccctgcacgggtaacaccaccttcagctacaacagccaagcctgtgagcgcacc
tgcctgtcgctgtcggaccgtgccaccgagtgccaccacagcgccgtgcccgtggacggt
tgcaactgccccgatggcacctacctgaaccaaaagggcgagtgtgtgcgcaaggcccag
tgcccgtgcatactggagggttacaagttcatcctggccgagcagtccactgtcatcaac
ggcatcacctgccactgcatcaacgggcggctgagttgcccgcagcggccacagatgttc
ctggcctcctgccaggcccctaagaccttcaagtcctgcagccagtcctccgagaacaag
tttggggcagcctgtgcccccacatgccagatgctggccaccggtgttgcctgcgtgccc
accaagtgtgagcctggctgtgtctgcgccgagggcctctacgagaatgccgacgggcag
tgtgtgccccccgaggagtgcccatgtgagttctcgggggtctcctaccctggaggagct
gagctccacactgactgcaggacctgctcctgctcaagggggaggtgggcctgtcagcag
ggcacccactgcccatccacctgcaccctctacggggagggccacgtcatcaccttcgac
ggccagcgcttcgtattcgacggcaactgcgagtacatcctggccacggacgtctgtggt
gtcaacgactcacagcccaccttcaagatcctgacagagaacgtcatctgtgggaactcc
ggggtcacatgctcacgggccatcaagatcttcctggggggcctgtccgtggtgctggcg
gacagaaactacacggtcaccggggaggagccccacgtgcagctcggggtgacgccgggt
gcgctgagccttgtcgtggacatcagcatccccgggaggtacaacctgacgctcatctgg
aacaggcacatgaccatcctcatcaggatcgcccgtgcctcccaggatcccctctgcggc
ttgtgtggcaacttcaacgggaacatgaaggacgacttcgagacgcgcagcaggtacgtg
gcatccagcgagctggagttggtgaactcgtggaaggagagcccgctgtgcggggacgtg
agcttcgtgacagacccctgcagtctcaatgccttccggcgctcctgggccgagcgcaag
tgcagcgtcatcaacagccagacctttgccacctgccacagcaaggtataccacctgccc
tactacgaggcctgcgtgcgcgacgcatgtgggtgtgacagtggcggggactgtgagtgt
ctgtgcgatgccgtggctgcctacgcccaagcctgtctggacaagggtgtgtgcgtggac
tggaggaccccggccttctgccccatctactgcggcttctacaacacgcacacgcaggac
ggccatggcgagtaccagtacacacaggaggccaactgcacgtggcactaccagccctgc
ctctgccccagccagccacagagcgtcccaggcagcaacatcgaaggctgctacaactgc
tcccaggatgagtacttcgaccacgaggagggggtgtgcgtgccctgcatgccgcccacc
acgccgcagccacccaccacgccgcagctgcccaccacaggctcacggcccacgcaagtc
tggcccatgacgggaacctccaccaccatcgggcttctcagctccaccggaccctcaccc
agctctaatcacacccctgccagccccacccagacacccctccttccagccacgctcaca
tcctccaagcccacagcctcctcgggagaaccacctagaccaaccacggccgtcacccca
caagccacatcagggctgcctcccacagccacactgagatcgacagccacaaaacccaca
gtgacccaggccacaaccagggccacggcgtcgaccgccagcccagccacgacgtccaca
gctcagtccacaacacggaccacaatgacactaccaaccccagccacatcagggacaagc
cccacgctgccaaaatcgaccaatcaggaactgccaggaacaacggccacccagacgaca
ggcccacgtccaaccccagcaagcaccacaggcccaaccaccccacagccaggacaaccc
acgaggcccacagccacagagaccactcaaacaagaacgactactgaatacacaacgccc
caaaccccacacaccacacactccccgcctacggcggggagtcccgtcccttccacaggt
cctgtcactgcaacatctttccatgccaccactacctatccaaccccatcacaccctgag
accacacttcccactcacgttccacctttctccacctccttggtgactccaagtactcac
acagtcatcacccctacccacgcacagatggccacatctgcctccaaccactcagcgcca
acaggtaccattcctccaccaacaacgctcaaggccacagggtccacccacacagcccca
ccaataacgccgaccaccagtgggaccagccaagcccacagctcattcagcacaaacaaa
acacctacctcgctacattcacacacttcctccacacaccatcctgaagtcaccccaact
tctactaccacgattactcccaaccccactagtacacgcaccagaacccctgtggcccac
accaactcagccaccagcagcaggccaccaccacccttcaccacacactccccacctaca
gggagcagtcccttctcttccacaggtcccatgacggcaacatccttcaagaccaccact
acctatccaaccccatcacaccctcagaccacacttcccactcacgttccacctttctcc
acctctttggtgactccaagtactcacacagtcatcacccctacccatgcacagatggcc
acttctgcctccatccactcaatgccaacaggcacgattcctccaccgacaacgctcaag
gccacagggtccacccacacagcgccaacaatgacgctgaccaccagcgggaccagccaa
gccctgagctcattaaacacagccaaaacctctacatccctacattcacacacttcctcc
acacaccatgctgaagccacctcaacttctaccaccaacatcacccccaaccccaccagt
acaggaaccccaccaatgacagtgaccaccagtgggaccagccaatcccgaagctcattt
agcacggccaaaacctctacatccctacattcacacacttcctccacacaccatcctgaa
gtcacctcaacttctaccaccagcatcacccccaaccacaccagtacaggcaccagaacc
cctgtggcccacaccacgtcggccaccagcagcaggctacccacacccttcaccacacac
tccccacctacagggaccactcccatctcttccacaggtcctgtcactgcaacatccttc
cagaccaccactacctatccaaccccatcacaccctcacaccacacttcccactcacgtt
ccatctttctccacctccttggtgactccaagtactcacacggtcatcatccctacccac
acacagatggccacttctgcctccatccactcaatgccaacaggcaccattcctccaccg
accacgatcaaggccacagggtccacccacacagccccaccaatgacaccgaccaccagt
gggaccagccaatccccaagctcatttagcacggccaaaacttctacatccctaccttac
cacacttcctcaacacaccatcctgaagtcaccccaacttctaccaccaacatcaccccc
aaacacaccagtacaggcaccagaacccctgtggcccacaccacctcggccagcagcagc
aggctacccacacccttcaccacacactccccacctacagggagcagtcccttctcttcc
acaggtcctatgactgcaacatccttccagaccaccactacctatccaaccccatcacac
cctcagaccacacttcccactcacgttccacctttctccacctccttggtgactccaagt
actcacacagtcatcatcactacccacacacagatggccacttctgcctccatccactca
acgccaacaggcaccgttcctccaccaacaacgctcaaggccacagggtccacccacaca
gccccaccaatgacagtgaccaccagtgggaccagccaaacccacagctcattcagcaca
gctacagcctcttcttccttcatatcctcctcgtcttggctgcctcagaactctagctca
aggccaccgtcatcacctatcaccacacaactcccccacttgagttctgcaaccactcct
gtttccacaactaatcagctgtcctcctcattttctcccagtccttctgccccctctact
gtttcttcttatgtgccctcctcccactcctctccccagacttcatcgccttctgttggc
acatcttcctctttcgtgtccgcccccgtgcactccacaaccctgagctcggggtcacac
tcctcattgtccactcatcccacgactgcatcagtgtctgcatctcctctttttccttct
tctccagctgcctctactaccattagggccactctcccccacactatctcctctcctttc
accctctctgctctactccccatatccactgttaccgtgtctcccaccccatccagccac
ctagcctccagcaccattgcatttccgtccacgcccaggaccacggccagcacccacacc
gcccctgccttctcctctcagtccaccacctcgcggtccacttctctcaccacccgagtt
cccacatcaggctttgtgtcactcacctcgggggtgacgggtatccccacctctccagtc
accaaccttaccaccaggcaccctggtcccaccttgtcgcctaccacacggttcctgacc
agctccctcactgcccatggaagcacccctgcttctgccccggtatcttctctcgggaca
cctacgcccacctcacccggggtctgcagtgtgcgggagcagcaggaggagatcacgttc
aaggggtgcatggcgaacgtgacggtaacccgctgtgagggcgcctgcatttccgctgcc
agcttcaacatcatcacccagcaggtggatgcccgctgcagctgctgccgccccctccac
tcctatgagcagcagctggagctgccctgccccgatcccagcacgcctggccggcggctc
gtactcaccctgcaggtgttcagccactgcgtgtgcagctctgtggcctgtggagactag

DBGET integrated database retrieval system