KEGG   Homo sapiens (human): 460
Entry
460               CDS       T01001                                 
Symbol
ASTN1, ASTN
Name
(RefSeq) astrotactin 1
  KO
K24479  astrotactin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    460 (ASTN1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   460 (ASTN1)
SSDB
Motif
Pfam: ASTN_1_2_N ASTN1_2_EGF_Fn Annexin_like FXa_inhibition Tme5_EGF_like MACPF UPF0560
Other DBs
NCBI-GeneID: 460
NCBI-ProteinID: NP_996991
OMIM: 600904
HGNC: 773
Ensembl: ENSG00000152092
Pharos: O14525(Tbio)
UniProt: O14525
Position
1:complement(176857321..177164712)
AA seq 1216 aa
MALAGLCALLACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPS
ASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLF
HIHHQDGAPSLPGQDPTEEPQHESAEEELRILHISVMGGMIALLLSILCLVMILYTRRRW
CKRRRVPQPQKSASAEAANEIHYIPSVLIGGHGRESLRNARVQGHNSSGTLSIRETPILD
GYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNK
YKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSGTEAENDPQLT
FYTDPSRSRRRSRVGSPRSPVNKTTLTLISITSCVIGLVCSSHVNCPLVVKITLHVPEHL
IADGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETG
ECLCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGE
GMWLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLEVLLDSFGP
VRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSGCYDRHIGVDCSDGFNGGC
EQLCLQQMAPFPDDPTLYNILMFCGCIEDYKLGVDGRSCQLITETCPEGSDCGESRELPM
NQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEE
ISEPTPDPDFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLNQVAISQALSNALHSLDGAT
SRADFVALLDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWLEYEDISKGNSPSDESEE
RERDPKVLTFPEYITSLSDSGTKHMAAGVRMECHSKGRCPSSCPLCHVTSSPDTPAEPVL
LEVTKAAPIYELVTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGADGLPTCAP
LPQPVLRLSTVHEPSSTLVVLEWEHSEPPIGVQIVDYLLRQEKVTDRMDHSKVETETVLS
FVDDIISGAKSPCAMPSQVPDKQLTTISLIIRCLEPDTIYMFTLWGVDNTGRRSRPSDVI
VKTPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVLYHYNQHYE
SFGEFTWRCEDELGPR
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggctttagccgggctctgcgccctgctcgcctgctgctgggggccggcggcggtgctg
gccacggccgccggcgacgtggatccatccaaggagctggagtgcaagctcaaaagcatc
acggtgtcggcactgcccttcctgcgcgagaacgacctgagcatcatgcacagcccctcg
gcctcggagcccaagctcctcttctcggtgcgcaacgacttcccgggagaaatggtcgtg
gtggacgacctggagaacacggagctgccctacttcgtgctggagatctcagggaacaca
gaggatatccctttggtgcgctggaggcagcagtggctggagaatggcactttgcttttt
cacattcatcaccaagatggtgccccaagccttcctggacaagaccccactgaagaaccc
caacatgagtcggcagaagaggagctgaggatcctccacatctcagtcatgggtggcatg
atcgctctgctgctgtccatcttgtgcctggtgatgatcctgtatactcgccggcgctgg
tgcaaacgccgccgggtcccgcagccccagaagagtgccagtgctgaggcagccaatgag
attcactacattccttctgtgctgatcggcgggcacggacgggagagcctgcgcaatgcc
cgcgtgcagggccacaactccagtggcaccctgagcatccgggagacacctatcctggac
ggctatgagtatgacatcactgatctgcgccaccatctgcagagggagtgcatgaacgga
ggggaggactttgccagccaggtcacgcgcaccctcgactccctgcagggctgcaatgaa
aagtcggggatggacctcacaccaggaagtgacaatgccaagctgtcactgatgaacaag
tataaagataatattatagccactagccctgtggactccaaccaccagcaagccaccctt
ctctctcacacctccagcagccagagaaagcggatcaacaacaaagcaagagctggttcc
gccttcttgaaccctgaaggggattctggcacagaggcagaaaacgacccccagctgacc
ttttacacggatccttcaaggagcaggaggcgtagtagagtgggttctccccgaagtcct
gtgaataagaccaccttgaccctgatcagcatcaccagctgtgtgattggcctcgtgtgc
tcctctcacgtcaactgccctctcgttgtcaagatcaccctgcatgtccctgagcacctg
attgctgatgggagccgcttcatcttgctggaggggagccagctggatgccagtgactgg
ctgaaccctgcccaagtggttctcttctctcagcagaactccagcggaccctgggccatg
gacctctgtgcccggcggctcctggacccctgtgaacaccaatgtgaccccgaaactggg
gaatgcctctgctatgaaggctacatgaaggatccagtacataagcacctttgcattcgg
aacgaatgggggacaaaccaggggccatggccttacacaatatttcagcgaggctttgac
ctggttttgggagagcagccctctgataaaatatttagattcacctacactcttggggag
ggcatgtggttgcccctcagcaagagctttgtgattccaccagccgaactggccatcaat
ccatcagcaaagtgcaagacggacatgactgtgatggaggatgctgtggaggtcagagag
gagctgatgacttcatcctccttcgacagcctggaggttctcttagattcctttgggccg
gtgcgcgactgcagcaaagataacgggggctgcagtaagaatttccgctgtatttcagat
cgcaagctggactccactggttgcgtgtgcccatctggactcagtcccatgaaggacagc
tctggctgctatgaccgccacatcggggtggactgttccgacggcttcaacggcggctgt
gagcagctgtgcctccagcagatggcgcccttcccggacgaccccaccttgtataacatc
ctcatgttctgtgggtgcatcgaggactacaagcttggtgtggatggacgctcttgccaa
ctcatcacggagacctgtccagagggaagtgactgtggggaaagcagggagcttcccatg
aaccagaccctctttggggagatgttctttggttacaacaaccattccaaggaagtggct
gccggacaggtgctgaaaggaacattcaggcaaaacaactttgctcgtggtttagaccag
caactgccagatggtcttgtggtggccactgtgcccctggagaatcaatgcctagaggag
atctcggagcccacccctgaccctgacttcctgactgggatggtgaacttcagtgaagtg
tctgggtaccctgtgctgcagcactggaaggtccggtctgtgatgtaccacatcaaactc
aaccaagtggccatctctcaggccctcagcaatgctctccactcgctggatggggctaca
tctcgtgcagattttgtggcgctgttggaccagttcggcaaccattacatccaggaagct
atctacggctttgaggagtcctgttctatctggtacccaaacaagcaggtccagcggcga
ctctggctggagtatgaagacatcagtaaaggcaactccccatcagatgagtctgaggag
cgggaaagagaccccaaggtgctgacattcccagaatacatcaccagcttgtcagactcc
ggcaccaagcacatggcggctggagtccgcatggagtgccacagcaagggacgatgcccc
tcgtcctgccccctgtgtcatgtgacatccagccctgacacccctgctgagccggttctg
ctggaggtgaccaaagcagcccccatctatgaactagtgaccaacaaccagacccagagg
ctcttgcaggaggctaccatgagctctctctggtgctcagggactggagatgtcatcgag
gactggtgtcgatgtgactccactgcttttggagctgatggactccccacctgtgcgcct
ctcccacagcctgtgctgagactctccacggttcacgagcccagcagcactcttgtggtc
ctggagtgggaacactcagagccaccaatcggggtgcagattgtagattacctcctccgt
caagagaaagtcactgacaggatggaccactccaaagtggagacagaaacagtgctgagc
tttgtggacgacatcatctctggagcaaagtctccttgtgcaatgccatctcaggtgccg
gacaagcagctcaccaccatctctctgatcatacgatgcctggaacctgacaccatttac
atgttcacgctgtggggagtggacaacacaggacggcgctccaggccaagcgacgtgatc
gtgaagaccccatgccccgtggtggatgatgtcaaggctcaagaaatagcagacaagatc
tacaatctcttcaatggctacactagtgggaaggagcagcagaccgcctacaacaccctc
ctggatctgggttcccccaccttacaccgggtcctctaccactataaccagcactatgag
agttttggggaattcacctggcgatgtgaggatgagttaggtcccaggtaa

DBGET integrated database retrieval system