KEGG   Homo sapiens (human): 4609Help
Entry
4609              CDS       T01001                                 

Gene name
MYC, MRTL, MYCC, bHLHe39, c-Myc
Definition
(RefSeq) MYC proto-oncogene, bHLH transcription factor
  KO
K04377  Myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05216  Thyroid cancer
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
Network
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to Wnt signaling pathway
N00077  HRAS-overexpression to RAS-ERK signaling pathway
N00078  Mutation-activated HRAS to RAS-ERK signaling pathway
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00110  PLZF-RARA fusion to transcriptional activtion
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to Wnt signaling pathway
N00258  Mutation-inactivated CDH1 to Wnt signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
Disease
H00001  B lymphoblastic leukemia/lymphoma
H00002  T lymphoblastic leukemia/lymphoma
H00008  Burkitt lymphoma
H00010  Multiple myeloma
H00013  Small cell lung cancer
H00016  Oral cancer
H00025  Penile cancer
H00027  Ovarian cancer
H00028  Choriocarcinoma
H00036  Osteosarcoma
H00041  Kaposi sarcoma
H00048  Hepatocellular carcinoma
H00055  Laryngeal cancer
H01463  Mycosis fungoides
H01509  Tonsillar cancer
H01554  Fallopian tube cancer
H01667  Medulloblastoma
Drug target
Omacetaxine mepesuccinate: D08956
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4609 (MYC)
   04012 ErbB signaling pathway
    4609 (MYC)
   04310 Wnt signaling pathway
    4609 (MYC)
   04350 TGF-beta signaling pathway
    4609 (MYC)
   04390 Hippo signaling pathway
    4609 (MYC)
   04630 Jak-STAT signaling pathway
    4609 (MYC)
   04151 PI3K-Akt signaling pathway
    4609 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4609 (MYC)
   04218 Cellular senescence
    4609 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4609 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4609 (MYC)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    4609 (MYC)
   05230 Central carbon metabolism in cancer
    4609 (MYC)
   05202 Transcriptional misregulation in cancers
    4609 (MYC)
   05206 MicroRNAs in cancer
    4609 (MYC)
   05205 Proteoglycans in cancer
    4609 (MYC)
   05210 Colorectal cancer
    4609 (MYC)
   05225 Hepatocellular carcinoma
    4609 (MYC)
   05226 Gastric cancer
    4609 (MYC)
   05216 Thyroid cancer
    4609 (MYC)
   05221 Acute myeloid leukemia
    4609 (MYC)
   05220 Chronic myeloid leukemia
    4609 (MYC)
   05219 Bladder cancer
    4609 (MYC)
   05213 Endometrial cancer
    4609 (MYC)
   05224 Breast cancer
    4609 (MYC)
   05222 Small cell lung cancer
    4609 (MYC)
  09167 Infectious diseases
   05166 HTLV-I infection
    4609 (MYC)
   05161 Hepatitis B
    4609 (MYC)
   05163 Human cytomegalovirus infection
    4609 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4609 (MYC)
   05169 Epstein-Barr virus infection
    4609 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4609 (MYC)
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    4609 (MYC)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4609 (MYC)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4609 (MYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Motif
Other DBs
NCBI-GeneID: 4609
NCBI-ProteinID: NP_002458
OMIM: 190080
HGNC: 7553
Ensembl: ENSG00000136997
Vega: OTTHUMG00000128475
Pharos: P01106(Tbio)
UniProt: P01106 A0A087WVR4
Structure
PDB: 

Position
8q24.21
AA seq 454 aa AA seqDB search
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ctggatttttttcgggtagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacacccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcgcctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgtcaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

DBGET integrated database retrieval system