KEGG   Homo sapiens (human): 4615Help
Entry
4615              CDS       T01001                                 

Gene name
MYD88, MYD88D
Definition
(RefSeq) MYD88, innate immune signal transduction adaptor
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05170  Human immunodeficiency virus 1 infection
Module
hsa_M00686  Toll-like receptor signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Disease
H00721  Pyogenic bacterial infections, recurrent, due to MYD88 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4615 (MYD88)
   04064 NF-kappa B signaling pathway
    4615 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    4615 (MYD88)
   04621 NOD-like receptor signaling pathway
    4615 (MYD88)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    4615 (MYD88)
   05133 Pertussis
    4615 (MYD88)
   05134 Legionellosis
    4615 (MYD88)
   05152 Tuberculosis
    4615 (MYD88)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    4615 (MYD88)
   05162 Measles
    4615 (MYD88)
   05164 Influenza A
    4615 (MYD88)
   05161 Hepatitis B
    4615 (MYD88)
   05168 Herpes simplex infection
    4615 (MYD88)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    4615 (MYD88)
   05145 Toxoplasmosis
    4615 (MYD88)
   05140 Leishmaniasis
    4615 (MYD88)
   05142 Chagas disease (American trypanosomiasis)
    4615 (MYD88)
   05143 African trypanosomiasis
    4615 (MYD88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TIR TIR_2
Motif
Other DBs
NCBI-GeneID: 4615
NCBI-ProteinID: NP_002459
OMIM: 602170
HGNC: 7562
Ensembl: ENSG00000172936
Vega: OTTHUMG00000131083
Pharos: Q99836(Tbio)
UniProt: Q99836 A0A0A0MS70
Structure
PDB: 

Position
3p22.2
AA seq 309 aa AA seqDB search
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY
LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWT
RLAKALSLP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccgaccgcgctgaggctccaggaccgcccgccatggctgcaggaggtcccggc
gcggggtctgcggccccggtctcctccacatcctcccttcccctggctgctctcaacatg
cgagtgcggcgccgcctgtctctgttcttgaacgtgcggacacaggtggcggccgactgg
accgcgctggcggaggagatggactttgagtacttggagatccggcaactggagacacaa
gcggaccccactggcaggctgctggacgcctggcagggacgccctggcgcctctgtaggc
cgactgctcgagctgcttaccaagctgggccgcgacgacgtgctgctggagctgggaccc
agcattgaggaggattgccaaaagtatatcttgaagcagcagcaggaggaggctgagaag
cctttacaggtggccgctgtagacagcagtgtcccacggacagcagagctggcgggcatc
accacacttgatgaccccctggggcatatgcctgagcgtttcgatgccttcatctgctat
tgccccagcgacatccagtttgtgcaggagatgatccggcaactggaacagacaaactat
cgactgaagttgtgtgtgtctgaccgcgatgtcctgcctggcacctgtgtctggtctatt
gctagtgagctcatcgaaaagaggtgccgccggatggtggtggttgtctctgatgattac
ctgcagagcaaggaatgtgacttccagaccaaatttgcactcagcctctctccaggtgcc
catcagaagcgactgatccccatcaagtacaaggcaatgaagaaagagttccccagcatc
ctgaggttcatcactgtctgcgactacaccaacccctgcaccaaatcttggttctggact
cgccttgccaaggccttgtccctgccctga

DBGET integrated database retrieval system