KEGG   Homo sapiens (human): 4626Help
Entry
4626              CDS       T01001                                 

Gene name
MYH8, DA7, MyHC-peri, MyHC-pn, gtMHC-F
Definition
(RefSeq) myosin heavy chain 8
  KO
K10352  myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Disease
H00811  Distal arthrogryposis
H00872  Trismus-pseudocamptodactyly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4626 (MYH8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4626 (MYH8)
   04147 Exosome [BR:hsa04147]
    4626 (MYH8)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4626 (MYH8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4626 (MYH8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N IQ AAA_22 AAA_16
Motif
Other DBs
NCBI-GeneID: 4626
NCBI-ProteinID: NP_002463
OMIM: 160741
HGNC: 7578
Ensembl: ENSG00000133020
Vega: OTTHUMG00000130361
Pharos: P13535(Tbio)
UniProt: P13535
Position
17p13.1
AA seq 1937 aa AA seqDB search
MSASSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGG
KVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTY
SGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILIT
GESGAGKTVNTKRVIQYFATIAVTGEKKKDESGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKN
KDPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNK
LMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGD
FKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMR
DEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIK
PLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADS
LADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDL
ELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKV
NILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLD
EKLEKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRS
DLSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHA
DSMAELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVS
ELKTKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKH
QLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYET
DAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNA
ACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLET
LRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGK
ILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKK
MEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALRGQEDLKEQLAIVERR
ANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQL
QSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRL
DEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEED
RKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQV
NKLRVKSREVHTKISAE
NT seq 5814 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgagctcagacgctgagatggctgtttttggcgaagctgctccctaccttcga
aaatcagaaaaggagcggattgaggcccaaaacaagccgtttgatgctaaaacatctgtc
tttgtggcggagcccaaggaatcctatgtgaagagcactatacaaagcaaagaaggaggg
aaagtaaccgtaaagactgaaggtggagcaactctaactgtcagggaagaccaagtcttc
cctatgaaccctccgaaatatgacaaaattgaggacatggccatgatgactcatctacac
gagcctggagtgctgtacaacctcaaagagcgctatgcagcctggatgatctacacctac
tcaggcctcttctgtgtcaccgtcaacccctacaagtggctgccggtgtacaagcccgag
gtggtggctgcctacagaggcaaaaagcgccaggaggccccgccccacatcttctccatc
tctgacaatgcctatcagttcatgttgactgatcgagagaatcagtccatcctgatcacc
ggagaatctggtgccggaaagactgtgaacaccaagcgtgtcatccaatactttgcaaca
attgcagttactggagagaagaagaaggatgaatctggcaaaatgcaggggactctggaa
gatcaaatcatcagcgccaatcccctactggaggcctttggcaatgccaaaactgtgagg
aatgacaactcctctcgctttggtaaattcattagaatccactttggtactacagggaag
ctggcatctgctgatatagaaacatatcttttagaaaagtccagagttactttccagcta
aaggcggaaagaagctaccatattttttatcagatcacttccaataagaagccagatcta
attgaaatgctcctgatcaccaccaacccatatgactatgccttcgtcagtcagggggag
atcacagttcccagtattgatgaccaagaagagttgatggccactgatagtgccattgac
atcctgggcttcactcctgaagagaaagtgtccatctataaactcacaggggctgtgatg
cattatgggaacatgaaattcaagcaaaagcagcgtgaggagcaagctgagccagatggc
acagaagtcgctgacaaggcagcctatctccagagtctgaactctgcagacctactcaaa
gccctctgctaccctagggtcaaggttggcaatgagtatgtcaccaaaggccagactgtg
cagcaggtgtacaatgcggtgggtgctctggccaaagccgtctacgagaagatgttcctg
tggatggtcacccgcatcaaccagcagctggacaccaagcagcccaggcagtacttcatc
ggggtcttggacattgctggctttgaaatctttgattttaacagcctggagcagctgtgc
atcaacttcaccaacgagaaactgcaacagtttttcaaccaccacatgtttgtgctagag
caggaggagtacaagaaggaaggcatcgagtggacgttcattgactttgggatggacctg
gctgcctgcattgagctcattgagaagccactgggcatcttctccatcctggaagaggag
tgcatgttccctaaggcaacggacacctccttcaagaacaagctgtatgaccagcacctg
ggcaagtctgccaacttccagaagcccaaggtggtcaaaggcaaggctgaggcccacttc
tctctgattcactatgctggcactgtggactacaacattactggctggctggacaaaaat
aaggaccccctgaatgatactgtggttgggctgtaccagaagtctgcaatgaagactcta
gccagtctcttttccacgtatgctagtgctgaagcagatagcagcgcgaagaaaggtgct
aagaaaaagggctcttctttccagactgtgtctgcccttttcagggaaaatttaaataaa
ttgatgacgaatctgaggagcacacaccctcacttcgtacggtgtatcattcccaatgaa
accaaaactcctggggcaatggaacatgaacttgtgttgcaccagctgaggtgtaatggt
gtgctggaaggcatccgcatctgtaggaaaggattcccaagcagaatcttatatggtgat
ttcaaacaaagatacaaggttttaaatgcaagtgctattccagagggacagttcattgac
agcaagaaggcttctgagaaacttcttgcatctattgatattgatcatactcaatataaa
tttggacataccaaggttttcttcaaagctggacttctgggtcttctggaagaaatgaga
gatgaaaaattagcccaaattataacaagaacacaagctgtctgtaggggattcctaatg
agggtagaatatcagaagatgttgcaaaggagagaagcacttttctgcatccagtataat
gtccgtgccttcatgaacgtcaagcactggccctggatgaaactctttttcaagattaag
cccctcctcaagagtgcagagaccgagaaagagatggccaccatgaaggaagaattccag
aaaaccaaagatgaactcgccaagtcagaggcaaaacggaaggagctagaggaaaaaatg
gtcactctcttaaaagagaaaaatgacctgcaactccaggttcaatctgaagcagatagc
ttggctgatgcagaggaaaggtgtgagcaactgattaaaaacaaaatccaacttgaggcc
aaaatcaaagaggtgactgaaagagctgaggaggaggaagagatcaatgctgagctgaca
gccaagaagagaaaactggaggatgaatgttcagaactcaagaaagacattgatgacctt
gagctgacactggccaaggttgagaaggagaaacatgccacggagaacaaggtgaaaaat
cttacagaagagatggcaggcctggatgaaaccattgcaaaactgtccaaggagaagaag
gctctccaagagacccaccagcagaccctggatgacctgcaggcagaggaggacaaagtc
aacatcctgaccaaagctaaaaccaagctagaacagcaagtggatgatcttgaagggtct
ctggaacaagaaaagaagcttcgaatggatctagaaagagcaaagcggaaactggagggt
gacctcaaattggcccaagaatccacaatggatatggaaaatgacaaacagcaacttgat
gaaaagcttgaaaagaaagaatttgaaatcagcaatttgataagcaaaattgaagatgag
caagctgtagaaattcaactacagaagaagatcaaagagttgcaggcccgcattgaggag
ctgggggaagaaatcgaggcagagagggcgtcccgagccaaagcggagaagcagcgctct
gacctctcccgggaactggaggagatcagcgagaggctggaagaagccggtggggcaact
tctgctcaggtggaattgaacaagaagcgggaggctgagtttcagaaactgcgcagggac
ctggaggaggccaccctgcagcatgaagctatggtggctgctcttcggaagaagcacgca
gacagtatggctgagcttggggagcagattgacaacttgcagcgggtcaaacagaagctg
gagaaggagaagagtgagctgaagatggagactgatgacctcagcagtaacgcagaggcc
atttccaaagccaagggaaaccttgaaaagatgtgccgctctctagaagatcaagtgagt
gagcttaagaccaaggaagaggagcagcagcggctgatcaatgacctcacagcacagaga
gcgcgcctgcagacagaagcgggtgaatattctcgacaattagatgagaaagatgcttta
gtctctcagctttcaaggagcaagcaagcatctactcagcagattgaagagctgaaacat
caactagaggaagaaactaaagccaagaacgccctggcacacgccctgcagtcctcccgc
catgactgcgacctgctgcgggaacagtatgaggaagagcaggaaggcaaagctgagctg
cagagggcgctgtccaaggccaacagtgaggttgcccagtggagaaccaaatacgagacg
gatgccatccagcgcacagaggagctggaggaggccaagaaaaagttggcccagcgcctg
caagaagctgaggaacatgtagaagctgtgaacgccaaatgtgcttcccttgagaagacg
aagcagcggctccagaatgaagttgaagacctcatgcttgatgtggaaaggtctaatgca
gcctgtgcagcccttgataagaagcaaaggaactttgacaaggtcctatcagaatggaag
cagaagtatgaggaaactcaggctgaacttgaggcctcccagaaggagtcacgttctctt
agcactgagctgttcaaggtgaagaatgtctatgaggaatccctggatcaactcgaaacg
ctaagaagagaaaataagaacttgcaacaggagatttctgacctcactgagcagattgca
gagggaggaaagcaaattcatgaattggagaaaataaagaagcaagtagaacaagagaaa
tgtgaaattcaggctgctttagaggaagcagaggcatctcttgaacatgaagaaggaaag
attctgcgtatccagcttgagttaaaccaagtcaagtctgaagttgatagaaaaatcgca
gaaaaggatgaggaaattgaccagctgaagagaaaccacactagagtcgtggagacaatg
cagagcacgctggatgcagagattagaagcagaaatgatgctctgagagtcaagaagaaa
atggaaggagatctgaatgaaatggaaatccagctgaaccatgccaatcgcttagctgca
gagagtttaaggaactacaggaacacccaaggaatcctgaaggaaacccagctccacctg
gatgatgctctccggggccaggaggacctcaaggaacagctggcaattgtggagcgcaga
gccaacctgctgcaggctgagatcgaggagctgtgggccactctggaacagacagagaga
agcaggaaaatcgccgaacaggagctcctggatgccagtgagcgtgtccagctcctccac
acccagaataccagtctcattaacaccaagaagaaattagaaaatgacgtttcccaactc
caaagtgaagtggaagaagtaatccaagaatcacgcaatgcagaagagaaagccaagaag
gccatcactgatgctgccatgatggctgaggagctgaagaaggaacaggacaccagcgcc
cacctggagcggatgaagaagaacctggagcagacggtgaaggacctgcagcatcgtcta
gatgaggccgagcagctggcgctgaagggtgggaagaagcagatccagaaactggaggcc
agggtacgtgagcttgaaggagaggttgaaaatgaacagaaacgtaatgcagaggctgtt
aaaggtttacggaaacatgagcgacgagtaaaagaactcacctaccagactgaagaagat
cgcaagaatgttctcaggctgcaggacttggtagataaattacaggcgaaggtgaaatca
tacaagagacaagctgaggaggctgaggaacaatccaatgctaatctatctaaattccgc
aaactccagcatgagctggaggaggccgaggaacgggctgacattgctgagtcccaggtc
aacaaattgcgagtgaagagccgagaggttcacacaaaaatcagtgcagagtaa

DBGET integrated database retrieval system