KEGG   Homo sapiens (human): 4627Help
Entry
4627              CDS       T01001                                 

Gene name
MYH9, BDPLT6, DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHC-IIA, NMMHCA
Definition
(RefSeq) myosin heavy chain 9
  KO
K10352  myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05132  Salmonella infection
Disease
H00233  MYH9-related disease
H00578  Epstein syndrome
H00604  Deafness, autosomal dominant
H01740  Macrothrombocytopenia
H02051  May-Hegglin anomaly
H02052  Sebastian syndrome
H02053  Fechtner syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4627 (MYH9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4627 (MYH9)
 09160 Human Diseases
  09167 Infectious diseases
   05132 Salmonella infection
    4627 (MYH9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4627 (MYH9)
   04147 Exosome [BR:hsa04147]
    4627 (MYH9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4627 (MYH9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4627 (MYH9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ CC2-LZ ADIP Reo_sigmaC AAA_22
Motif
Other DBs
NCBI-GeneID: 4627
NCBI-ProteinID: NP_002464
OMIM: 160775
HGNC: 7579
Ensembl: ENSG00000100345
Vega: OTTHUMG00000030429
Pharos: P35579(Tbio)
UniProt: P35579 A0A024R1N1
Structure
PDB: 

Position
22q12.3
AA seq 1960 aa AA seqDB search
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
NT seq 5883 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcaagctgccgataagtatctctatgtggataaaaacttcatcaacaatccg
ctggcccaggccgactgggctgccaagaagctggtatgggtgccttccgacaagagtggc
tttgagccagccagcctcaaggaggaggtgggcgaagaggccatcgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgacatccagaagatgaacccgcccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcctcggtgctgcacaac
ctcaaggagcgttactactcagggctcatctacacctattcaggcctgttctgtgtggtc
atcaatccttacaagaacctgcccatctactctgaagagattgtggaaatgtacaagggc
aagaagaggcacgagatgccccctcacatctatgccatcacagacaccgcctacaggagt
atgatgcaagaccgagaagatcaatccatcttgtgcactggtgaatctggagctggcaag
acggagaacaccaagaaggtcatccagtatctggcgtacgtggcgtcctcgcacaagagc
aagaaggaccagggcgagctggagcggcagctgctgcaggccaaccccatcctggaggcc
ttcgggaacgccaagaccgtgaagaatgacaactcctcccgcttcggcaaattcattcgc
atcaactttgatgtcaatggctacattgttggagccaacattgagacttatcttttggag
aaatctcgtgctatccgccaagccaaggaagaacggaccttccacatcttctattatctc
ctgtctggggctggagagcacctgaagaccgatctcctgttggagccgtacaacaaatac
cgcttcctgtccaatggacacgtcaccatccccgggcagcaggacaaggacatgttccag
gagaccatggaggccatgaggattatgggcatcccagaagaggagcaaatgggcctgctg
cgggtcatctcaggggttcttcagctcggcaacatcgtcttcaagaaggagcggaacact
gaccaggcgtccatgcccgacaacacagctgcccaaaaggtgtcccatctcttgggtatc
aatgtgaccgatttcaccagaggaatcctcaccccgcgcatcaaggtgggacgggattac
gtccagaaggcgcagactaaagagcaggctgactttgccatcgaggccttggccaaggcg
acctatgagcggatgttccgctggctggtgctgcgcatcaacaaggctctggacaagacc
aagaggcagggcgcctccttcatcgggatcctggacattgccggcttcgagatctttgat
ctgaactcgtttgagcagctgtgcatcaattacaccaatgagaagctgcagcagctcttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgcgagggcatcgagtggaac
ttcatcgactttggcctcgacctgcagccctgcatcgacctcattgagaagccagcaggc
cccccgggcattctggccctgctggacgaggagtgctggttccccaaagccaccgacaag
agcttcgtggagaaggtgatgcaggagcagggcacccaccccaagttccagaagcccaag
cagctgaaggacaaagctgatttctgcattatccactatgccggcaaggtggattacaaa
gctgacgagtggctgatgaagaacatggatcccctgaatgacaacatcgccacactgctc
caccagtcctctgacaagtttgtctcggagctgtggaaggatgtggaccgcatcatcggc
ctggaccaggtggccggcatgtcggagaccgcactgcccggggccttcaagacgcggaag
ggcatgttccgcactgtggggcagctttacaaggagcagctggccaagctgatggctacg
ctgaggaacacgaaccccaactttgtccgctgcatcatccccaaccacgagaagaaggcc
ggcaagctggacccgcatctcgtgctggaccagctgcgctgcaacggtgttctcgagggc
atccgtatctgccgccagggcttccccaacagggtggtcttccaggagtttcggcagaga
tatgagatcctgactccaaactccattcccaagggtttcatggacgggaagcaggcgtgc
gtgctcatgataaaagccctggagctcgacagcaatctgtaccgcattggccagagcaaa
gtcttcttccgtgccggtgtgctggcccacctggaggaggagcgagacctgaagatcacc
gacgtcatcatagggttccaggcctgctgcaggggctacctggccaggaaagcatttgcc
aagcggcagcagcagcttaccgccatgaaggtcctccagcggaactgcgctgcctacctg
aagctgcggaactggcagtggtggcggctcttcaccaaggtcaagccgctgctgcaggtg
agccggcaggaggaggagatgatggccaaggaggaggagctggtgaaggtcagagagaag
cagctggctgcggagaacaggctcacggagatggagacgctgcagtctcagctcatggca
gagaaattgcagctgcaggagcagctccaggcagaaaccgagctgtgtgccgaggctgag
gagctccgggcccgcctgaccgccaagaagcaggaattagaagagatctgccatgaccta
gaggccagggtggaggaggaggaggagcgctgccagcacctgcaggcggagaagaagaag
atgcagcagaacatccaggagcttgaggagcagctggaggaggaggagagcgcccggcag
aagctgcagctggagaaggtgaccaccgaggcgaagctgaaaaagctggaggaggagcag
atcatcctggaggaccagaactgcaagctggccaaggaaaagaaactgctggaagacaga
atagctgagttcaccaccaacctcacagaagaggaggagaaatctaagagcctcgccaag
ctcaagaacaagcatgaggcaatgatcactgacttggaagagcgcctccgcagggaggag
aagcagcgacaggagctggagaagacccgccggaagctggagggagactccacagacctc
agcgaccagatcgccgagctccaggcccagatcgcggagctcaagatgcagctggccaag
aaagaggaggagctccaggccgccctggccagagtggaagaggaagctgcccagaagaac
atggccctcaagaagatccgggagctggaatctcagatctctgaactccaggaagacctg
gagtctgagcgtgcttccaggaataaagctgagaagcagaaacgggaccttggggaagag
ctagaggctctgaaaacagagttggaggacacgctggattccacagctgcccagcaggag
ctcaggtcaaaacgtgagcaggaggtgaacatcctgaagaagaccctggaggaggaggcc
aagacccacgaggcccagatccaggagatgaggcagaagcactcacaggccgtggaggag
ctggcggagcagctggagcagacgaagcgggtgaaagcaaacctcgagaaggcaaagcag
actctggagaacgagcggggggagctggccaacgaggtgaaggtgctgctgcagggcaaa
ggggactcggagcacaagcgcaagaaagtggaggcgcagctgcaggagctgcaggtcaag
ttcaacgagggagagcgcgtgcgcacagagctggccgacaaggtcaccaagctgcaggtg
gagctggacaacgtgaccgggcttctcagccagtccgacagcaagtccagcaagctcacc
aaggacttctccgcgctggagtcccagctgcaggacactcaggagctgctgcaggaggag
aaccggcagaagctgagcctgagcaccaagctcaagcaggtggaggacgagaagaattcc
ttccgggagcagctggaggaggaggaggaggccaagcacaacctggagaagcagatcgcc
accctccatgcccaggtggccgacatgaaaaagaagatggaggacagtgtggggtgcctg
gaaactgctgaggaggtgaagaggaagctccagaaggacctggagggcctgagccagcgg
cacgaggagaaggtggccgcctacgacaagctggagaagaccaagacgcggctgcagcag
gagctggacgacctgctggtggacctggaccaccagcgccagagcgcgtgcaacctggag
aagaagcagaagaagtttgaccagctcctggcggaggagaagaccatctctgccaagtat
gcagaggagcgcgaccgggctgaggcggaggcccgagagaaggagaccaaggctctgtcg
ctggcccgggccctggaggaagccatggagcagaaggcggagctggagcggctcaacaag
cagttccgcacggagatggaggaccttatgagctccaaggatgatgtgggcaagagtgtc
cacgagctggagaagtccaagcgggccctagagcagcaggtggaggagatgaagacgcag
ctggaagagctggaggacgagctgcaggccaccgaagatgccaagctgcggttggaggtc
aacctgcaggccatgaaggcccagttcgagcgggacctgcagggccgggacgagcagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcagagctggaggac
gagaggaagcagcgctcgatggcagtggccgcccggaagaagctggagatggacctgaag
gacctggaggcgcacatcgactcggccaacaagaaccgggacgaagccatcaaacagctg
cggaagctgcaggcccagatgaaggactgcatgcgcgagctggatgacacccgcgcctct
cgtgaggagatcctggcccaggccaaagagaacgagaagaagctgaagagcatggaggcc
gagatgatccagttgcaggaggaactggcagccgcggagcgtgccaagcgccaggcccag
caggagcgggatgagctggctgacgagatcgccaacagcagcggcaaaggagccctggcg
ttagaggagaagcggcgtctggaggcccgcatcgcccagctggaggaggagctggaggag
gagcagggcaacacggagctgatcaacgaccggctgaagaaggccaacctgcagatcgac
cagatcaacaccgacctgaacctggagcgcagccacgcccagaagaacgagaatgctcgg
cagcagctggaacgccagaacaaggagcttaaggtcaagctgcaggagatggagggcact
gtcaagtccaagtacaaggcctccatcaccgccctcgaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcagcctgcaaacaggtgcgtcggacc
gagaagaagctgaaggatgtgctgctgcaggtggatgacgagcggaggaacgccgagcag
tacaaggaccaggccgacaaggcatctacccgcctgaagcagctcaagcggcagctggag
gaggccgaagaggaggcccagcgggccaacgcctcccgccggaaactgcagcgcgagctg
gaggacgccactgagacggccgatgccatgaaccgcgaagtcagctccctaaagaacaag
ctcaggcgcggggacctgccgtttgtcgtgccccgccgaatggcccggaaaggcgccggg
gatggctccgacgaagaggtagatggcaaagcggatggggctgaggccaaacctgccgaa
taa

DBGET integrated database retrieval system