KEGG   Homo sapiens (human): 4636Help
Entry
4636              CDS       T01001                                 

Gene name
MYL5, MYLC2
Definition
(RefSeq) myosin light chain 5
  KO
K12753  myosin regulatory light chain 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    4636 (MYL5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    4636 (MYL5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4636 (MYL5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4636 (MYL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DUF945 EFhand_Ca_insen Caleosin SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 4636
NCBI-ProteinID: NP_002468
OMIM: 160782
HGNC: 7586
Ensembl: ENSG00000215375
Vega: OTTHUMG00000159971
Pharos: Q02045(Tdark)
UniProt: Q02045
Position
4p16.3
AA seq 173 aa AA seqDB search
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca
tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca
ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc
tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg
gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac
gccgaggagaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc
aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag
gtggaccagatgttccagttcgcctccatcgatgtggcgggcaacctggactacaaggcg
ctcagctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system