KEGG   Homo sapiens (human): 4642
Entry
4642              CDS       T01001                                 

Gene name
MYO1D, PPP1R108, myr4
Definition
(RefSeq) myosin ID
  KO
K10356  myosin I
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4642 (MYO1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    4642 (MYO1D)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4642 (MYO1D)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4642 (MYO1D)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4642 (MYO1D)
   04147 Exosome [BR:hsa04147]
    4642 (MYO1D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4642 (MYO1D)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Others
    4642 (MYO1D)
 Others
  Actin-binding proteins
   Myosins
    4642 (MYO1D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    4642 (MYO1D)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4642 (MYO1D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4642 (MYO1D)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ Zeta_toxin AAA_18 AAA_22 Sigma54_activat AAA_16 TsaE
Other DBs
NCBI-GeneID: 4642
NCBI-ProteinID: NP_056009
OMIM: 606539
HGNC: 7598
Ensembl: ENSG00000176658
Vega: OTTHUMG00000179636
Pharos: O94832(Tbio)
UniProt: O94832 Q8N618
Position
17q11.2
AA seq 1006 aa
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGR
DTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIA
AITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGH
INNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSS
INDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSII
AELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRIN
DIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLG
KHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSN
PVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQI
FDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVK
KLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKR
TKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLRRFEEALQTIF
NRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIP
LYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHL
QVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggcggagcaggagagcctggaattcggcaaggcagacttcgtgctgatggacaccgtc
tccatgcccgagttcatggccaacctcaggctcagatttgaaaaagggcgcatctatacg
ttcattggagaagtcgtcgtttctgtgaacccttacaagttgttgaacatctatggaaga
gacacaattgagcagtataaaggccgtgagctgtatgagagaccgcctcacctttttgct
attgcggatgctgcttacaaggctatgaagaggcgatcaaaagacacttgtattgtgata
tcaggggaaagtggagctggtaaaacggaagccagtaagtacattatgcagtatattgcg
gccatcaccaaccccagtcagagagcagaggttgaaagagtgaagaatatgttgcttaag
tccaactgtgttttggaagcttttggaaatgccaaaaccaaccgtaatgacaactcaagc
aggtttggaaaatacatggatatcaactttgacttcaagggtgaccctattggtgggcat
atcaataactacttactagaaaagtctcgagtgattgtgcaacagccaggagaaagaagc
tttcattctttctatcagctactccaaggaggttcagaacaaatgctacgctctctacat
ctccagaaatccctttcatcctacaactatattcatgtgggagctcaattaaagtcttct
atcaatgatgctgccgaattcagagttgttgctgatgccatgaaagtcattggcttcaaa
cctgaggagatccaaacagtgtataagattttggctgctattctgcacttgggaaattta
aaatttgtagtagatggtgacacgcctcttattgagaatggcaaagtagtatctatcata
gcagaattgctctctactaagacagatatggttgagaaagcccttctttaccggactgtg
gccacaggccgtgacatcattgacaagcagcacacagaacaagaggccagctacggcaga
gacgcctttgccaaggcaatatatgagcgccttttttgttggatcgttactcgcatcaat
gatattattgaggtcaagaactatgacaccacaatccatgggaaaaacactgttattggt
gtcttggatatctatggctttgaaatctttgacaacaacagttttgaacaattctgtatc
aattactgcaatgagaaactgcagcagctatttattcagctggttctgaagcaagaacaa
gaggaataccagcgggaagggatcccctggaaacatattgactacttcaacaatcagatc
attgttgacctcgtggagcaacagcacaaagggatcattgcaatccttgatgatgcttgc
atgaatgtcggcaaagtcaccgatgaaatgtttcttgaagcacttaacagtaaattgggc
aaacacgcccatttttccagccgaaagctctgtgcctcagacaaaattctggagtttgat
cgagattttcgaattcgacattatgcaggcgatgtagtctattctgtcattggttttatt
gacaaaaataaagatactttatttcaagatttcaagcgccttatgtataacagttcaaat
cctgtgctcaagaatatgtggcctgaaggcaaactgagcattacagaggtgaccaagcga
cctctgactgctgctaccttgtttaagaattctatgattgctctagtagacaaccttgca
tcaaaggaaccatattacgttcgttgcatcaaacccaatgacaagaaatctccacagata
tttgatgatgaacgctgccggcaccaagtagaatatcttggactactggaaaatgtgaga
gtgcgtcgggcaggatttgccttccgccagacatacgagaagtttcttcacaggtataag
atgatctctgaattcacctggcccaaccatgaccttccttcagacaaagaggctgtcaag
aaactaattgaacggtgtggttttcaggatgatgtagcttatgggaagaccaaaattttc
attcgaacaccccgaacattgtttaccttggaagaactccgtgcccagatgctcataagg
attgtcctctttctacaaaaggtgtggcggggcaccctggcccgcatgcggtacaaaaga
accaaggcagctctgacaataatcaggtactaccggcgctacaaagtgaagtcgtacatc
cacgaggtggccagacgcttccatggcgtcaagaccatgcgagactacgggaagcacgtg
aagtggccaagccctcctaaagttcttcgccgttttgaggaggccctgcagacgattttc
aatagatggagagcatcccagctcatcaagagcattccggcctcagacctgccccaggtc
agggcaaaggttgcagccgtggaaatgttgaagggtcaaagggctgacctcgggctccag
agggcctgggagggcaactatcttgcttcaaagccagatacacctcagacctcaggcact
tttgtccctgttgctaatgaattgaaacggaaggacaaatacatgaatgtcctcttttcc
tgtcacgtccgtaaggtaaatcgatttagtaaggtggaagacagagcaatttttgtcact
gaccgtcacctgtataaaatggatcccactaaacagtacaaggtgatgaagactatccct
ctatacaatttgactggtctgagtgtctccaatggaaaggaccaacttgtagtgttccat
acgaaagacaacaaagacctcattgtctgcctcttcagcaaacagccaacccatgagagt
cgaattggagaacttgttggagtgctggtgaatcatttcaagagtgagaagcgccacctt
caagtgaacgtcaccaacccagtacagtgcagcctgcacgggaagaagtgcaccgtctcc
gtggagacgcggctcaaccagccccagcccgacttcaccaagaatcgctcgggcttcatc
ctcagcgtgcccgggaactga

DBGET integrated database retrieval system