KEGG   Homo sapiens (human): 4650Help
Entry
4650              CDS       T01001                                 

Gene name
MYO9B, CELIAC4, MYR5
Definition
(RefSeq) myosin IXB
  KO
K10360  myosin IX
Organism
hsa  Homo sapiens (human)
Disease
H02123  Celiac disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4650 (MYO9B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4650 (MYO9B)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    4650 (MYO9B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4650 (MYO9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head RhoGAP IQ RA C1_1 AAA_22 T2SSE
Motif
Other DBs
NCBI-GeneID: 4650
NCBI-ProteinID: NP_004136
OMIM: 602129
HGNC: 7609
Ensembl: ENSG00000099331
Vega: OTTHUMG00000182707
Pharos: Q13459(Tbio)
UniProt: Q13459 B0I1T6 Q8WVD2
Structure
PDB: 

Position
19p13.11
AA seq 2157 aa AA seqDB search
MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGT
KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VHMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGA
QSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
LLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQASWRGYWQRKL
YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGGQGQAAGG
QQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRV
SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
AASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLPSLAKAQPAAETTDGE
RSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
VSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHV
GYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKK
RKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH
CSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAA
NRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDN
SDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPL
KLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDI
TYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPTPSPLPTV
AAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG
NT seq 6474 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagaggcaggcagctcgggccgccgggagcaggcggcctaccacctgcac
atctacccccagctgtccaccaccgagagccaggcctcgtgccgcgtgactgccaccaag
gacagcaccacctcggacgtcatcaaggacgccattgccagcctgcggctggacggcacc
aaatgttatgtgctggtggaggtcaaagagtcgggaggcgaggaatgggtgctggacgcc
aacgactcgcctgtgcaccgggtgctgctatggccccggcgggcacaggacgagcaccct
caggaggatggctactacttcctgctgcaggagcgcaacgcagatggaaccatcaagtac
gtgcatatgcagctggtggcgcaggccacagccacccggcgcctagtggagcgtggcctc
ctgccacggcagcaggcggactttgatgacctgtgtaacctccccgagctaaccgagggc
aacctcctgaagaacctcaagcaccgcttcctgcaacaaaagatctacacgtacgcgggg
agcatcctggtggccatcaacccctttaagttcctgcccatctacaaccccaagtacgtg
aagatgtatgagaaccagcagctgggcaagctggagccacacgtcttcgcgctggccgac
gtggcctactacaccatgctcaggaagcgcgtgaaccagtgcatcgtgatctcgggtgag
agcggctccggcaagacccagagcaccaacttcctcatccactgcctcaccgccctcagc
cagaagggctacgccagcggcgtcgagaggaccatcctgggtgctggccctgtgctggag
gcttttggaaatgccaagacagcccacaacaacaactccagccggtttgggaaattcatc
caagtcagctacctagagagtggcatcgtgagaggagctgtcgtcgagaaatatctgctt
gaaaagtctcgcctggtgtctcaggagaaggatgagaggaactaccatgtgttttattat
ttgttacttggggtcagcgaggaagagcgccaagaatttcagctcaagcagcctgaagat
tatttctacctcaaccagcataacttgaagattgaagatggggaggacctgaagcatgac
tttgagaggctcaagcaggccatggagatggtgggcttcctccccgccaccaagaagcag
atttttgccgtcctctcggccatcctgtacctgggcaacgtcacttataagaagagagct
acaggccgagaggaagggttggaggtcgggccacccgaggtgctggacaccctgtcgcag
cttctgaaggtgaagcgagaaatcttggtggaggttctgaccaaaagaaaaacggtgacc
gtcaacgacaagcttatccttccctacagcctcagcgaggccatcactgcccgcgactcc
atggccaagtctctgtacagcgccctgttcgactggattgtgctgcggatcaaccacgca
ctcctcaacaagaaggacgtggaagaggcagtctcgtgcctgtccattggggtcctggac
atcttcgggtttgaagacttcgagaggaacagctttgagcagttctgcatcaactacgcc
aatgagcagctgcagtattacttcaaccagcacatcttcaagctggagcaggaggaatat
cagggcgaggggatcacgtggcacaacatcggctacacagacaatgtcggctgcatccat
ctcatcagcaagaaacccacgggcctcttctacctgctggacgaggagagcaacttcccc
cacgccacgagccagaccctgctggccaagttcaaacagcaacatgaggacaataagtac
ttcctgggcaccccggtcatggagccagctttcatcatccagcacttcgcagggaaggtg
aaatatcagatcaaggacttccgggagaagaacatggactacatgcggccagacatcgtg
gccctgctgcggggcagtgacagctcctacgtgcgggagctcatcggcatggaccccgtg
gccgtgttccgctgggccgtgctccgggctgctatccgggccatggcagtgcttcgggag
gccggacgcctgcgggccgagagggccgaaaaggctgcaggtatgagcagccctggtgcc
caaagtcacccagaagagctgccaagaggagccagcaccccttcggaaaaactttaccgc
gatttgcataaccaaatgatcaagagcatcaaaggattgccctggcagggcgaggacccc
cgtagccttctccagtccctcagtcggctccagaaaccccgcgccttcatcctgaaaagt
aaaggtatcaaacaaaagcagatcattccaaagaacctactggactccaagtccctgaaa
ctcatcatcagcatgactctgcacgaccgcaccaccaagtccctactgcacctgcacaag
aagaaaaagccaccaagcatcagcgcccagttccagacatcccttaacaagctcttggag
gcactggggaaggcggagcccttctttatccgctgcatccgttccaatgctgaaaagaaa
gagctgtgctttgacgacgagctggtcctgcagcagctgcgctacaccggcatgctggag
accgtgcgcatccggaggtcagggtacagcgccaagtacacgttccaggatttcaccgag
cagttccaggtgctcctgcccaaggatgcccagccctgcagggaggtcatctccaccctc
ctggagaaaatgaagatagacaagaggaactaccagatcgggaagaccaaggtcttcctg
aaggagacggagcggcaagccctgcaggagacgctgcaccgggaggtggtgcggaaaatc
ctgctgctgcagagctggttccggatggtgctggagcgtcggcacttcctgcagatgaag
cgggccgccgtcaccatccaggcctgctggcggtcctaccgggtccggagggcgctggag
aggacgcaggctgccgtgtacctccaggcctcatggaggggctactggcagcggaagctc
taccggcaccagaaacagagcatcatccgcctgcagagcctgtgtcgggggcacctgcag
cgcaagagcttcagccagatgatctcggagaagcagaaggcagaagagaaggagagggaa
gccctggaagccgcaagagcaggtgctgaggagggcggacagggtcaggcggctggaggg
cagcaggtagctgagcaggggccggagccagcggaggatggcgggcacctggcatcggag
cctgaggtgcagccaagtgacaggtcccccctagagcactcctcacctgagaaggaggcc
ccaagcccagagaagactctcccaccccagaaaaccgtggcggctgaaagtcacgagaaa
gtccccagcagccgggagaagcgtgagtcgcgtcggcaaagagggctggagcacgtcaag
ttccagaacaaacacatccagtcctgcaaggaggagagtgccctcagagaaccttccaga
agggtcacccaggagcaaggggtgagtctcctggaagacaaaaaggagagcagagaagat
gaaacccttctagtcgtagagacggaggctgagaacacatctcaaaagcagcccacagag
caaccccaggccatggcagttggcaaggtctctgaagaaactgagaagacgctgcccagt
gggagccccaggcctggccagttggagcggccgaccagcctggccctggacagcagggtc
agcccaccggcccctggcagcgcccccgagacccccgaggacaagagcaaaccatgtggc
agcccaagggttcaggaaaagcccgacagccccggaggctccacgcagatccagcggtac
ctggacgccgagcggctggccagcgccgtggaactgtggcggggcaagaagctggtggcc
gccgccagccctagtgccatgctcagccagtccctggacctcagcgacagacaccgggcc
acaggggccgccctcacgcccacagaggagaggcgcacctccttctccacgagcgacgtc
tccaagctcctcccgtccctggccaaggctcagcctgcagcagaaaccacggacggagag
cgaagtgcgaaaaagccagctgtccagaagaagaagccaggcgacgcatcctccctccca
gacgcagggctgtccccgggctctcaggtcgactctaaatccacgtttaagaggcttttt
ctgcataaaaccaaggataaaaaatacagcctggagggcgcagaggagctggagaatgca
gtgtccgggcacgtggtgctggaagccaccaccatgaagaagggcctggaagccccctcc
ggacagcagcatcgccacgctgcaggtgagaagcgcaccaaggaaccaggaggcaaaggg
aagaagaaccgaaatgtcaagattgggaagatcacagtgtcagagaagtggcgggaatcg
gtgttccgccagatcaccaacgccaatgagctcaagtacctggacgagttcctgctcaac
aagataaatgacctccgttcccagaagacgcccattgagagcttgtttatcgaagccacc
gagaagttcaggagcaacatcaaaacgatgtactctgtcccgaacgggaagatccacgtg
ggctacaaggatctgatggagaactaccagatcgtcgtcagcaacctggccactgagcgt
ggccagaaggacaccaacctggtcctcaacctcttccagtcactgctagatgagttcacc
cgtggctacaccaagaacgacttcgagccagtgaagcagagcaaagctcagaagaagaag
cggaagcaggagcgtgctgtccaggagcacaacgggcacgtgttcgccagctaccaggtt
agcatcccgcagtcgtgcgagcagtgcctctcctatatctggctcatggacaaggccctg
ctctgcagcgtgtgcaagatgacctgccacaagaagtgcgtgcacaagattcagagccac
tgctcctacacctacgggaggaagggcgagccaggcgttgagcctggccacttcggcgtg
tgcgtagacagcctgaccagcgacaaggcctcggtgcccatcgtgctggagaagctcctg
gaacacgtggagatgcacggcctgtacaccgagggcctctaccgcaagtcgggtgctgcc
aaccgcactcgggagctccggcaggcgctgcagacagaccccgcagcagtcaagctggag
aacttccccatccacgccatcacaggggtgctgaagcagtggctgcgggagctgcccgag
cccctcatgaccttcgcacagtacggcgacttcctccgagccgtcgagctgccggagaag
caggagcagctggctgccatctatgccgtcctggagcaccttccagaagccaaccacaac
tccctggagagactcatcttccaccttgtcaaggtggccctgctcgaggatgtcaaccgc
atgtcacctggggcgctggccattatcttcgcaccctgcctcctgcgctgccctgacaac
tcggacccgctgaccagcatgaaggacgtcctcaagatcaccacgtgcgtggagatgctg
atcaaggagcagatgaggaaatacaaagtgaagatggaggagatcagccaactggaggct
gcagagagtatcgccttccgcaggctttcgctcctgcgacaaaatgctccatggcctctc
aaactggggttttcgtctccctatgagggggtcctgaacaagagccccaagacccgggac
atccaggaggaggagctggaggtgctgctggaggaggaggcagccggcggcgatgaggac
cgggaaaaggagattctcattgaacggatccagtccatcaaggaggagaaggaggacatc
acctaccggctgccggagctggacccaaggggctcggacgaggagaacctggactcggag
acgtcggccagcaccgagagcctgctggaggagcgggccgggcggggggcctcggaaggg
ccccctgcgcctgctctcccttgccccggcgcgcccaccccgagccccctccccaccgtg
gccgcccctccacgacgaaggccgtcgtccttcgtaacggtcagagtgaagaccccccgg
cggacccccatcatgcccacggccaacatcaagctcccaccaggcctgccctcccacctg
cctcgctgggcaccgggtgcccgggaggcggctgccccagtgcggcgccgggagccacct
gcccgccgcccggaccagatacattccgtgtacatcacgcccggggcagacctgccagtg
cagggcgccctggagcccctagaagaggatggccagccacctggggccaagcggaggtac
tcggatcccccaacgtactgcctgccccccgcctcgggccagaccaatggctga

DBGET integrated database retrieval system