KEGG   Homo sapiens (human): 4653Help
Entry
4653              CDS       T01001                                 

Gene name
MYOC, GLC1A, GPOA, JOAG, JOAG1, TIGR
Definition
(RefSeq) myocilin
  KO
K23027  myocilin
Organism
hsa  Homo sapiens (human)
Disease
H00612  Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4653 (MYOC)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     4653 (MYOC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OLF APG6_N BRE1 NYD-SP28_assoc FPP ATG16 Cep57_MT_bd YabA PEP-utilisers_N ADIP V_ATPase_I Exonuc_VII_L Spc7
Motif
Other DBs
NCBI-GeneID: 4653
NCBI-ProteinID: NP_000252
OMIM: 601652
HGNC: 7610
Ensembl: ENSG00000034971
Vega: OTTHUMG00000034789
Pharos: Q99972(Tbio)
UniProt: Q99972 A0A0S2Z421
Structure
PDB: 

Position
1q24.3
AA seq 504 aa AA seqDB search
MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESS
CPEQSQAMSVIHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRE
LGTLRRERDQLETQTRELETAYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARL
RRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRILKESPSGYLRSGE
GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFE
YDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEI
PGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN
IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYN
PLEKKLFAWDNLNMVTYDIKLSKM
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcttctgtgcacgttgctgcagctttgggcctgagatgccagctgtccagctg
ctgcttctggcctgcctggtgtgggatgtgggggccaggacagctcagctcaggaaggcc
aatgaccagagtggccgatgccagtataccttcagtgtggccagtcccaatgaatccagc
tgcccagagcagagccaggccatgtcagtcatccataacttacagagagacagcagcacc
caacgcttagacctggaggccaccaaagctcgactcagctccctggagagcctcctccac
caattgaccttggaccaggctgccaggccccaggagacccaggaggggctgcagagggag
ctgggcaccctgaggcgggagcgggaccagctggaaacccaaaccagagagttggagact
gcctacagcaacctcctccgagacaagtcagttctggaggaagagaagaagcgactaagg
caagaaaatgagaatctggccaggaggttggaaagcagcagccaggaggtagcaaggctg
agaaggggccagtgtccccagacccgagacactgctcgggctgtgccaccaggctccaga
gaagtttctacgtggaatttggacactttggccttccaggaactgaagtccgagctaact
gaagttcctgcttcccgaattttgaaggagagcccatctggctatctcaggagtggagag
ggagacaccggatgtggagaactagtttgggtaggagagcctctcacgctgagaacagca
gaaacaattactggcaagtatggtgtgtggatgcgagaccccaagcccacctacccctac
acccaggagaccacgtggagaatcgacacagttggcacggatgtccgccaggtttttgag
tatgacctcatcagccagtttatgcagggctacccttctaaggttcacatactgcctagg
ccactggaaagcacgggtgctgtggtgtactcggggagcctctatttccagggcgctgag
tccagaactgtcataagatatgagctgaataccgagacagtgaaggctgagaaggaaatc
cctggagctggctaccacggacagttcccgtattcttggggtggctacacggacattgac
ttggctgtggatgaagcaggcctctgggtcatttacagcaccgatgaggccaaaggtgcc
attgtcctctccaaactgaacccagagaatctggaactcgaacaaacctgggagacaaac
atccgtaagcagtcagtcgccaatgccttcatcatctgtggcaccttgtacaccgtcagc
agctacacctcagcagatgctaccgtcaactttgcttatgacacaggcacaggtatcagc
aagaccctgaccatcccattcaagaaccgctataagtacagcagcatgattgactacaac
cccctggagaagaagctctttgcctgggacaacttgaacatggtcacttatgacatcaag
ctctccaagatgtga

DBGET integrated database retrieval system