KEGG   Homo sapiens (human): 4656
Entry
4656              CDS       T01001                                 

Gene name
MYOG, MYF4, bHLHc3, myf-4
Definition
(RefSeq) myogenin
  KO
K18483  myogenic factor 4 (myogenin)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4656 (MYOG)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    4656 (MYOG)
SSDB
Motif
Pfam: Basic HLH DUF3080
Other DBs
NCBI-GeneID: 4656
NCBI-ProteinID: NP_002470
OMIM: 159980
HGNC: 7612
Ensembl: ENSG00000122180
Vega: OTTHUMG00000042127
Pharos: P15173(Tbio)
UniProt: P15173
Position
1q32.1
AA seq 224 aa
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFS
ANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
NT seq 675 nt   +upstreamnt  +downstreamnt
atggagctgtatgagacatccccctacttctaccaggaaccccgcttctatgatggggaa
aactacctgcctgtccacctccagggcttcgaaccaccaggctacgagcggacggagctc
accctgagccccgaggccccagggccccttgaggacaaggggctggggacccccgagcac
tgtccaggccagtgcctgccgtgggcgtgtaaggtgtgtaagaggaagtcggtgtccgtg
gaccggcggcgggcggccacactgagggagaagcgcaggctcaagaaggtgaatgaggcc
ttcgaggccctgaagagaagcaccctgctcaaccccaaccagcggctgcccaaggtggag
atcctgcgcagtgccatccagtacatcgagcgcctccaggccctgctcagctccctcaac
caggaggagcgtgacctccgctaccggggcgggggcgggccccagccaggggtgcccagc
gaatgcagctctcacagcgcctcctgcagtccagagtggggcagtgcactggagttcagc
gccaacccaggggatcatctgctcacggctgaccctacagatgcccacaacctgcactcc
ctcacctccatcgtggacagcatcacagtggaagatgtgtctgtggccttcccagatgaa
accatgcccaactga

DBGET integrated database retrieval system