KEGG   Homo sapiens (human): 467Help
Entry
467               CDS       T01001                                 

Gene name
ATF3
Definition
(RefSeq) activating transcription factor 3
  KO
K09032  activating transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    467 (ATF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    467 (ATF3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    467 (ATF3)
   AP-1(-like) components, CRE-BP/ATF
    467 (ATF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Nnf1 Vfa1 Afi1 Ribosomal_L6e CHDCT2 Fungal_TACC
Motif
Other DBs
NCBI-GeneID: 467
NCBI-ProteinID: NP_001025458
OMIM: 603148
HGNC: 785
Ensembl: ENSG00000162772
Vega: OTTHUMG00000036747
Pharos: P18847(Tbio)
UniProt: P18847
Position
1q32.3
AA seq 181 aa AA seqDB search
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcaacacccaggccaggtctctgcctcggaagtgagtgcttctgccatcgtc
ccctgcctgtcccctcctgggtcactggtgtttgaggattttgctaacctgacgcccttt
gtcaaggaagagctgaggtttgccatccagaacaagcacctctgccaccggatgtcctct
gcgctggaatcagtcactgtcagcgacagacccctcggggtgtccatcacaaaagccgag
gtagcccctgaagaagatgaaaggaaaaagaggcgacgagaaagaaataagattgcagct
gcaaagtgccgaaacaagaagaaggagaagacggagtgcctgcagaaagagtcggagaag
ctggaaagtgtgaatgctgaactgaaggctcagattgaggagctcaagaacgagaagcag
catttgatatacatgctcaaccttcatcggcccacgtgtattgtccgggctcagaatggg
aggactccagaagatgagagaaacctctttatccaacagataaaagaaggaacattgcag
agctaa

DBGET integrated database retrieval system