KEGG   Homo sapiens (human): 4670Help
Entry
4670              CDS       T01001                                 

Gene name
HNRNPM, CEAR, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1, hnRNP_M
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein M
  KO
K12887  heterogeneous nuclear ribonucleoprotein M
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4670 (HNRNPM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    4670 (HNRNPM)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4670 (HNRNPM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 HnRNP_M RRM_3 Limkain-b1 Collagen_mid RRM_occluded RRM_5
Motif
Other DBs
NCBI-GeneID: 4670
NCBI-ProteinID: NP_005959
OMIM: 160994
HGNC: 5046
Ensembl: ENSG00000099783
Vega: OTTHUMG00000182383
Pharos: P52272(Tbio)
UniProt: P52272
Structure
PDB: 

Position
19p13.2
AA seq 730 aa AA seqDB search
MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNR
FEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFK
MEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIP
PSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKD
GKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG
LGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGMEGPFGGGMENM
GRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMG
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIG
SGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAG
LERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPAL
GAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNL
PFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGR
EIDVRIDRNA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggggtcgaagcggcggcggaggtggcggcgacggagatcaaaatggaggaa
gagagcggcgcgcccggcgtgccgagcggcaacggggctccgggccctaagggtgaagga
gaacgacctgctcagaatgagaagaggaaggagaaaaacataaaaagaggaggcaatcgc
tttgagccatatgccaatccaactaaaagatacagagccttcattacaaacatacctttt
gatgtgaaatggcagtcacttaaagacctggttaaagaaaaagttggtgaggtaacatac
gtggagctcttaatggacgctgaaggaaagtcaaggggatgtgctgttgttgaattcaag
atggaagagagcatgaaaaaagctgcggaagtcctaaacaagcatagtctgagcggaaga
ccactgaaagtcaaagaagatcctgatggtgaacatgccaggagagcaatgcaaaaggtg
atggctacgactggtgggatgggtatgggaccaggtggcccaggaatgattactatccca
cccagtatcctaaataatcccaacatcccaaatgagattatccatgcattacaggctgga
agacttggaagcacagtatttgtagcaaatctggattataaagttggctggaagaaactg
aaggaagtatttagtatggctggtgtggtggtccgagcagacattcttgaagataaagat
ggaaaaagtcgtggaataggcactgttacttttgaacagtccattgaagctgtgcaagct
atatctatgttcaatggccagctgctatttgatagaccaatgcacgtcaagatggatgag
agggccttaccaaaaggagatttcttccctcctgagcgtccacaacaacttccccatggc
cttggtggtattggcatggggttaggaccaggagggcaacccattgatgccaatcacctg
aataaaggcatcggaatgggaaacataggtcccgcaggaatgggaatggaaggcatagga
tttggaataaataaaatgggaggaatggaggggccctttggtggtggtatggaaaacatg
ggtcgatttggatctgggatgaacatgggcaggataaatgaaatcctaagtaatgcactg
aagagaggagagatcattgcaaagcagggaggaggtggaggtggaggaagcgtccctggg
atcgagaggatgggtcctggcattgaccgcctcgggggtgccggcatggagcgcatgggc
gcgggcctgggccacggcatggatcgcgtgggctccgagatcgagcgcatgggcctggtc
atggaccgcatgggctccgtggagcgcatgggctccggcattgagcgcatgggcccgctg
ggcctcgaccacatggcctccagcattgagcgcatgggccagaccatggagcgcattggc
tctggcgtggagcgcatgggtgccggcatgggcttcggccttgagcgcatggccgctccc
atcgaccgtgtgggccagaccattgagcgcatgggctctggcgtggagcgcatgggccct
gccatcgagcgcatgggcctgagcatggagcgcatggtgcccgcaggtatgggagctggc
ctggagcgcatgggccccgtgatggatcgcatggccaccggcctggagcgcatgggcgcc
aacaatctggagcggatgggcctggagcgcatgggcgccaacagcctcgagcgcatgggc
ctggagcgcatgggtgccaacagcctcgagcgcatgggccctgccatgggcccggccctg
ggcgctggcattgagcgcatgggcctggccatgggtggcggtggcggtgccagctttgac
cgtgccatcgagatggagcgtggcaacttcggaggaagcttcgcaggttcctttggtgga
gctggaggccatgctcctggggtggccaggaaggcctgccagatatttgtgagaaatctg
ccattcgatttcacatggaagatgctaaaggacaaattcaacgagtgcggccacgtgctg
tacgccgacatcaagatggagaatgggaagtccaaggggtgtggcgtggttaagttcgag
tcgccagaggtggccgagagagcctgccggatgatgaatggcatgaagctgagtggccga
gagattgacgttcgaattgatagaaacgcttaa

DBGET integrated database retrieval system