KEGG   Homo sapiens (human): 4671
Entry
4671              CDS       T01001                                 

Gene name
NAIP, BIRC1, NLRB1, psiNAIP
Definition
(RefSeq) NLR family apoptosis inhibitory protein
  KO
K12807  baculoviral IAP repeat-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4671 (NAIP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4671 (NAIP)
   05132 Salmonella infection
    4671 (NAIP)
   05131 Shigellosis
    4671 (NAIP)
   05134 Legionellosis
    4671 (NAIP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4671 (NAIP)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    4671 (NAIP)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   4671 (NAIP)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   4671 (NAIP)
SSDB
Motif
Pfam: BIR NLRC4_HD NACHT NOD2_WH NB-ARC LRR_4 AAA_30 AAA_22 DUF2075 AAA
Other DBs
NCBI-GeneID: 4671
NCBI-ProteinID: NP_001333799
OMIM: 600355
HGNC: 7634
Ensembl: ENSG00000249437
Vega: OTTHUMG00000163318
Pharos: Q13075(Tbio)
UniProt: Q13075
Structure
PDB: 
2VM5

Position
5q13.2
AA seq 1403 aa
MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSE
AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRF
HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV
LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSEEITQYI
QSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA
KAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQS
RGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLL
KKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQ
QLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIK
AFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTPLFVAAICAHWFQYPFDPS
FDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDED
EDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYHLKQINS
PMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNL
QYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEW
ERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEIL
MTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLE
SLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSVIPEEFPNFHHMEKLLIQISA
EYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSDSFFQAVPFVA
SLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ
QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNM
PNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKER
HPQSKYLTILQKWILPFSPIIQK
NT seq 4212 nt   +upstreamnt  +downstreamnt
atggccacccagcagaaagcctctgacgagaggatctcccagtttgatcacaatttgctg
ccagagctgtctgctcttctgggcctagatgcagttcagttggcaaaggaactagaagaa
gaggagcagaaggagcgagcaaaaatgcagaaaggctacaactctcaaatgcgcagtgaa
gcaaaaaggttaaagacttttgtgacttatgagccgtacagctcatggataccacaggag
atggcggccgctgggttttacttcactggggtaaaatctgggattcagtgcttctgctgt
agcctaatcctctttggtgccggcctcacgagactccccatagaagaccacaagaggttt
catccagattgtgggttccttttgaacaaggatgttggtaacattgccaagtacgacata
agggtgaagaatctgaagagcaggctgagaggaggtaaaatgaggtaccaagaagaggag
gctagacttgcgtccttcaggaactggccattttatgtccaagggatatccccttgtgtg
ctctcagaggctggctttgtctttacaggtaaacaggacacggtacagtgtttttcctgt
ggtggatgtttaggaaattgggaagaaggagatgatccttggaaggaacatgccaaatgg
ttccccaaatgtgaatttcttcggagtaagaaatcctcagaggaaattacccagtatatt
caaagctacaagggatttgttgacataacgggagaacattttgtgaattcctgggtccag
agagaattacctatggcatcagcttattgcaatgacagcatctttgcttacgaagaacta
cggctggactcttttaaggactggccccgggaatcagctgtgggagttgcagcactggcc
aaagcaggtcttttctacacaggtataaaggacatcgtccagtgcttttcctgtggaggg
tgtttagagaaatggcaggaaggtgatgacccattagacgatcacaccagatgttttccc
aattgtccatttctccaaaatatgaagtcctctgcggaagtgactccagaccttcagagc
cgtggtgaactttgtgaattactggaaaccacaagtgaaagcaatcttgaagattcaata
gcagttggtcctatagtgccagaaatggcacagggtgaagcccagtggtttcaagaggca
aagaatctgaatgagcagctgagagcagcttataccagcgccagtttccgccacatgtct
ttgcttgatatctcttccgatctggccacggaccacttgctgggctgtgatctgtctatt
gcttcaaaacacatcagcaaacctgtgcaagaacctctggtgctgcctgaggtctttggc
aacttgaactctgtcatgtgtgtggagggtgaagctggaagtggaaagacggtcctcctg
aagaaaatagcttttctgtgggcatctggatgctgtcccctgttaaacaggttccagctg
gttttctacctctcccttagttccaccagaccagacgaggggctggccagtatcatctgt
gaccagctcctagagaaagaaggatctgttactgaaatgtgcgtgaggaacattatccag
cagttaaagaatcaggtcttattccttttagatgactacaaagaaatatgttcaatccct
caagtcataggaaaactgattcaaaaaaaccacttatcccggacctgcctattgattgct
gtccgtacaaacagggccagggacatccgccgatacctagagaccattctagagatcaaa
gcatttcccttttataatactgtctgtatattacggaagctcttttcacataatatgact
cgtctgcgaaagtttatggtttactttggaaagaaccaaagtttgcagaagatacagaaa
actcctctctttgtggcggcgatctgtgctcattggtttcagtatccttttgacccatcc
tttgatgatgtggctgttttcaagtcctatatggaacgcctttccttaaggaacaaagcg
acagctgaaattctcaaagcaactgtgtcctcctgtggtgagctggccttgaaagggttt
ttttcatgttgctttgagtttaatgatgatgatctcgcagaagcaggggttgatgaagat
gaagatctaaccatgtgcttgatgagcaaatttacagcccagagactaagaccattctac
cggtttttaagtcctgccttccaagaatttcttgcggggatgaggctgattgaactcctg
gattcagataggcaggaacatcaagatttgggactgtatcatttgaaacaaatcaactca
cccatgatgactgtaagcgcctacaacaattttttgaactatgtctccagcctcccttca
acaaaagcagggcccaaaattgtgtctcatttgctccatttagtggataacaaagagtca
ttggagaatatatctgaaaatgatgactacttaaagcaccagccagaaatttcactgcag
atgcagttacttaggggattgtggcaaatttgtccacaagcttacttttcaatggtttca
gaacatttactggttcttgccctgaaaactgcttatcaaagcaacactgttgctgcgtgt
tctccatttgttttgcaattccttcaagggagaacactgactttgggtgcgcttaactta
cagtactttttcgaccacccagaaagcttgtcattgttgaggagcatccacttcccaata
cgaggaaataagacatcacccagagcacatttttcagttctggaaacatgttttgacaaa
tcacaggtgccaactatagatcaggactatgcttctgcctttgaacctatgaatgaatgg
gagcgaaatttagctgaaaaagaggataatgtaaagagctatatggatatgcagcgcagg
gcatcaccagaccttagtactggctattggaaactttctccaaagcagtacaagattccc
tgtctagaagtcgatgtgaatgatattgatgttgtaggccaggatatgcttgagattcta
atgacagttttctcagcttcacagcgcatcgaactccatttaaaccacagcagaggcttt
atagaaagcatccgcccagctcttgagctgtctaaggcctctgtcaccaagtgctccata
agcaagttggaactcagcgcagccgaacaggaactgcttctcaccctgccttccctggaa
tctcttgaagtctcagggacaatccagtcacaagaccaaatctttcctaatctggataag
ttcctgtgcctgaaagaactgtctgtggatctggagggcaatataaatgttttttcagtc
attcctgaagaatttccaaacttccaccatatggagaaattattgatccaaatttcagct
gagtatgatccttccaaactagtaaaattaattcaaaattctccaaaccttcatgttttc
catctgaagtgtaacttcttttcggattttgggtctctcatgactatgcttgtttcctgt
aagaaactcacagaaattaagttttcggattcattttttcaagccgtcccatttgttgcc
agtttgccaaattttatttctctgaagatattaaatcttgaaggccagcaatttcctgat
gaggaaacatcagaaaaatttgcctacattttaggttctcttagtaacctggaagaattg
atccttcctactggggatggaatttatcgagtggccaaactgatcatccagcagtgtcag
cagcttcattgtctccgagtcctctcatttttcaagactttgaatgatgacagcgtggtg
gaaattgccaaagtagcaatcagtggaggtttccagaaacttgagaacctaaagctttca
atcaatcacaagattacagaggaaggatacagaaatttctttcaagcactggacaacatg
ccaaacttgcaggagttggacatctccaggcatttcacagagtgtatcaaagctcaggcc
acaacagtcaagtctttgagtcaatgtgtgttacgactaccaaggctcattagactgaac
atgttaagttggctcttggatgcagatgatattgcattgcttaatgtcatgaaagaaaga
catcctcaatctaagtacttaactattctccagaaatggatactgccgttctctccaatc
attcagaaataa

DBGET integrated database retrieval system