KEGG   Homo sapiens (human): 4673
Entry
4673              CDS       T01001                                 

Gene name
NAP1L1, NAP1, NAP1L, NRP
Definition
(RefSeq) nucleosome assembly protein 1 like 1
  KO
K11279  nucleosome assembly protein 1-like 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4673 (NAP1L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     4673 (NAP1L1)
SSDB
Motif
Pfam: NAP
Other DBs
NCBI-GeneID: 4673
NCBI-ProteinID: NP_001317160
OMIM: 164060
HGNC: 7637
Ensembl: ENSG00000187109
Vega: OTTHUMG00000169786
Pharos: P55209(Tbio)
UniProt: P55209 A0A024RBB7 Q9H2B0
Position
12q21.2
AA seq 391 aa
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLV
ETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEI
INAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDL
LSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPD
DSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNF
FAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEE
ADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcagacattgacaacaaagaacagtctgaacttgatcaagatttggatgatgttgaa
gaagtagaagaagaggaaactggtgaagaaacaaaactcaaagcacgtcagctaactgtt
cagatgatgcaaaatcctcagattcttgcagcccttcaagaaagacttgatggtctggta
gaaacaccaacaggatacattgaaagcctgcctagggtagttaaaagacgagtgaatgct
ctcaaaaacctgcaagttaaatgtgcacagatagaagccaaattctatgaggaagttcac
gatcttgaaaggaagtatgctgttctctatcagcctctatttgataagcgatttgaaatt
attaatgcaatttatgaacctacggaagaagaatgtgaatggaaaccagatgaagaagat
gagatttcggaggaattgaaagaaaaggccaagattgaagatgagaaaaaagatgaagaa
aaagaagaccccaaaggaattcctgaattttggttaactgtttttaagaatgttgacttg
ctcagtgatatggttcaggaacacgatgaacctattctgaagcacttgaaagatattaaa
gtgaagttctcagatgctggccagcctatgagttttgtcttagaatttcactttgaaccc
aatgaatattttacaaatgaagtgctgacaaagacatacaggatgaggtcagaaccagat
gattctgatcccttttcttttgatggaccagaaattatgggttgtacagggtgccagata
gattggaaaaaaggaaagaatgtcactttgaaaactattaagaagaagcagaaacacaag
ggacgtgggacagttcgtactgtgactaaaacagtttccaatgactctttctttaacttt
tttgcccctcctgaagttcctgagagtggagatctggatgatgatgctgaagctatcctt
gctgcagacttcgaaattggtcactttttacgtgagcgtataatcccaagatcagtgtta
tattttactggagaagctattgaagatgatgatgatgattatgatgaagaaggtgaagaa
gcggatgaggaaggggaagaagaaggagatgaggaaaatgatccagactatgacccaaag
aaggatcaaaacccagcagagtgcaagcagcagtga

DBGET integrated database retrieval system