KEGG   Homo sapiens (human): 4676Help
Entry
4676              CDS       T01001                                 

Gene name
NAP1L4, NAP1L4b, NAP2, NAP2L, hNAP2
Definition
(RefSeq) nucleosome assembly protein 1 like 4
  KO
K11282  nucleosome assembly protein 1-like 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4676 (NAP1L4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     4676 (NAP1L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAP Muted Mst1_SARAH Lzipper-MIP1
Motif
Other DBs
NCBI-GeneID: 4676
NCBI-ProteinID: NP_005960
OMIM: 601651
HGNC: 7640
Ensembl: ENSG00000205531
Vega: OTTHUMG00000011009
Pharos: Q99733(Tbio)
UniProt: Q99733 A0A024RCC9
Position
11p15.4
AA seq 375 aa AA seqDB search
MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLP
KAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAE
SEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEY
DEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFE
GPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASG
DGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGD
EEGEDEDDAEINPKV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcacagtttttcagatggggttccttcagattccgtggaagctgctaaaaat
gcaagtaacacagaaaagctcacagatcaggtgatgcagaatcctcgagttctggcagct
ttacaggagcgacttgacaatgtccctcacaccccttccagctacatcgaaactttacct
aaagcagtaaaaagaagaattaatgcattgaaacaacttcaggtgagatgtgctcacata
gaagccaagttctatgaagaggtacatgacttggaaagaaagtatgcagcgctataccag
cctctctttgacaagagaagagaatttatcaccggcgatgttgaaccaacagatgcggaa
tcggaatggcacagtgaaaatgaagaggaagagaaattggctggagacatgaaaagtaaa
gtagtcgtcacagaaaaagcagcggcaacggctgaagagccagatcccaaaggaattcca
gagttctggtttaccatcttcagaaatgtggacatgctgagtgaattagtccaggaatat
gatgaaccaatcttgaaacacctgcaggatattaaagtgaaattttctgaccctggacag
cctatgtcttttgtgttagagttccactttgaacccaacgactactttaccaactcagtc
ctgacaaaaacctacaagatgaaatcagaaccagataaggctgatcccttttcctttgaa
ggtcctgagattgtggactgtgacgggtgtactattgactggaagaaaggaaagaatgtt
actgtcaaaaccatcaagaaaaagcagaagcataagggtcgaggcactgttagaacaatt
acgaaacaagtacccaatgagtcctttttcaacttcttcaatccattgaaagcatccggg
gatggagaatcactggatgaagattctgaattcacattagcctctgattttgaaattgga
cactttttccgtgagcggatagtcccgcgggctgtgctgtacttcactggggaggccata
gaagatgatgacaattttgaagaaggtgaagaaggagaagaggaggaattagaaggtgac
gaggagggagaagacgaggatgatgcggaaattaaccccaaggtgtaa

DBGET integrated database retrieval system