KEGG   Homo sapiens (human): 4677Help
Entry
4677              CDS       T01001                                 

Gene name
NARS, ASNRS, NARS1
Definition
(RefSeq) asparaginyl-tRNA synthetase
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4677 (NARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    4677 (NARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    4677 (NARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     4677 (NARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4677 (NARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4677 (NARS)
 Prokaryotic Type
    4677 (NARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 4677
NCBI-ProteinID: NP_004530
OMIM: 108410
HGNC: 7643
Ensembl: ENSG00000134440
Vega: OTTHUMG00000180125
Pharos: O43776(Tbio)
UniProt: O43776
Structure
PDB: 

Position
18q21.31
AA seq 548 aa AA seqDB search
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISK
SQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGAL
EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVA
VYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGE
NMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSS
QLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCD
VVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIP
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIF
DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYP
RFVQRCTP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtgctagcagagctgtacgtctctgaccgagagggaagcgatgccacgggagatgga
accaaggagaaaccatttaaaacaggtctaaaggctttgatgacagtagggaaagaacca
tttcctaccatttacgtagattcacaaaaagaaaatgagaggtggaatgttatttctaaa
tcacagttgaagaacattaaaaagatgtggcatagggaacaaatgaagagtgaatcccgg
gaaaagaaagaggcagaagatagtttacgaagagaaaagaacctggaagaagcaaagaag
attaccattaaaaatgatccaagtctcccagagccaaaatgtgtgaagattggtgcgtta
gaaggatatagaggccaaagagtaaaggtgtttggctgggtccacaggctgcgcaggcaa
ggaaagaatttaatgtttctggtgttgcgagatggtacaggttatcttcagtgtgtcttg
gcggatgagttgtgtcagtgctacaatggagttctcttgtccacggagagcagtgttgca
gtgtatggaatgctaaatcttaccccaaagggcaagcaggctccaggtggccatgagctg
agttgtgacttctgggaactaattgggttggcccctgctggaggagctgacaacctgatc
aatgaggagtctgacgttgatgtccagctcaacaacagacacatgatgatccgaggagaa
aacatgtccaaaatcctaaaagcacgatccatggtcaccaggtgctttagagatcacttc
tttgatagggggtactatgaagttactcctccaacattagtgcaaacacaagtagaaggt
ggtgccacactcttcaagcttgactattttggggaagaggcatttttgactcaatcctct
cagttgtacttggagacctgcctcccagccctgggagatgttttttgtattgctcagtca
taccgggcagagcagtccagaacacgaaggcacctggctgagtacactcacgtggaagct
gagtgtcctttcctgacttttgacgacctcctgaaccggttggaggacttggtttgtgat
gtggtagatcgaatattgaagtcacctgcagggagcatagtgcatgagctcaacccgaac
tttcagccccccaaacggcctttcaaacggatgaactattcagatgctatcgtttggcta
aaagaacatgatgtaaagaaagaagatggaactttctatgaatttggagaagatatccca
gaagctcctgagagactgatgacagacaccattaatgaaccaatcttgctgtgtcgattt
cctgtggagatcaagtccttctacatgcagcgatgtcctgaggattcccgtcttactgaa
tctgtcgacgtgttgatgcccaatgttggtgagattgtgggaggctcaatgcgtatcttt
gatagtgaagaaatactggcaggttataaaagggaagggattgaccccactccctattac
tggtatacggatcagagaaaatacggtacatgtccccatggaggatatggcttgggcttg
gaacgattcttaacgtggattctgaataggtatcacatccgagacgtgtgcttataccct
cgatttgtccagcgttgcacgccataa

DBGET integrated database retrieval system