KEGG   Homo sapiens (human): 468Help
Entry
468               CDS       T01001                                 

Gene name
ATF4, CREB-2, CREB2, TAXREB67, TXREB
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04137  Mitophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04934  Cushing's syndrome
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    468 (ATF4)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    468 (ATF4)
   04668 TNF signaling pathway
    468 (ATF4)
   04022 cGMP - PKG signaling pathway
    468 (ATF4)
   04151 PI3K-Akt signaling pathway
    468 (ATF4)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    468 (ATF4)
  Cell growth and death
   04210 Apoptosis
    468 (ATF4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    468 (ATF4)
   04922 Glucagon signaling pathway
    468 (ATF4)
   04912 GnRH signaling pathway
    468 (ATF4)
   04915 Estrogen signaling pathway
    468 (ATF4)
   04926 Relaxin signaling pathway
    468 (ATF4)
   04918 Thyroid hormone synthesis
    468 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    468 (ATF4)
   04925 Aldosterone synthesis and secretion
    468 (ATF4)
   04927 Cortisol synthesis and secretion
    468 (ATF4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    468 (ATF4)
  Nervous system
   04725 Cholinergic synapse
    468 (ATF4)
   04728 Dopaminergic synapse
    468 (ATF4)
   04720 Long-term potentiation
    468 (ATF4)
   04722 Neurotrophin signaling pathway
    468 (ATF4)
  Aging
   04211 Longevity regulating pathway - mammal
    468 (ATF4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    468 (ATF4)
   05215 Prostate cancer
    468 (ATF4)
  Substance dependence
   05030 Cocaine addiction
    468 (ATF4)
   05031 Amphetamine addiction
    468 (ATF4)
   05034 Alcoholism
    468 (ATF4)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    468 (ATF4)
   04934 Cushing's syndrome
    468 (ATF4)
  Infectious diseases
   05166 HTLV-I infection
    468 (ATF4)
   05161 Hepatitis B
    468 (ATF4)
   05163 Human cytomegalovirus infection
    468 (ATF4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    468 (ATF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 IncA Taxilin DUF4407 APG6 Fez1 Nop53 Laminin_II AAA_13 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 468
NCBI-ProteinID: NP_001666
OMIM: 604064
HGNC: 786
Ensembl: ENSG00000128272
Vega: OTTHUMG00000151099
Pharos: P18848(Tbio)
UniProt: P18848
Structure
PDB: 

Position
22q13.1
AA seq 351 aa AA seqDB search
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgattacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtccctccaacaacagcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgacttggatgccctgttg
ggtatagatgacctggaaaccatgccagatgaccttctgaccacgttggatgacacttgt
gatctctttgcccccctagtccaggagactaataagcagcccccccagacggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttctta
caacctcttcccctttccccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatcactgaaggagataggaagccagactacactgcttac
gttgccatgatccctcagtgcataaaggaggaagacaccccttcagataatgatagtggc
atctgtatgagcccagagtcctatctggggtctcctcagcacagcccctctaccaggggc
tctccaaataggagcctcccatctccaggtgttctctgtgggtctgcccgtcccaaacct
tacgatcctcctggagagaagatggtagcagcaaaagtaaagggtgagaaactggataag
aagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcggagcaggaggctcttactggtgagtgcaaagagctggaaaagaagaacgaggctcta
aaagagagggcggattccctggccaaggagatccagtacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system