KEGG   Homo sapiens (human): 4680Help
Entry
4680              CDS       T01001                                 

Gene name
CEACAM6, CD66c, CEAL, NCA
Definition
(RefSeq) carcinoembryonic antigen related cell adhesion molecule 6
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Drug target
Arcitumomab: D02977
Cergutuzumab: D11110
Cergutuzumab amunaleukin: D10917
Indium (111In) pentetic acid (DG01189): D04524
Labetuzumab: D08936
Technetium (99mTc) arcitumomab: D06028
Yttrium Y 90 labetuzumab: D06350
Yttrium Y 90 labetuzumab tetraxetan: D06351
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4680 (CEACAM6)
   04090 CD molecules [BR:hsa04090]
    4680 (CEACAM6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    4680 (CEACAM6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4680 (CEACAM6)
  Exosomal proteins of bladder cancer cells
   4680 (CEACAM6)
CD molecules [BR:hsa04090]
 Proteins
  4680 (CEACAM6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  4680 (CEACAM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 V-set I-set ig Ig_6 Ig_4 Adeno_E3_CR1 Ig_5 Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 4680
NCBI-ProteinID: NP_002474
OMIM: 163980
HGNC: 1818
Ensembl: ENSG00000086548
Vega: OTTHUMG00000151064
Pharos: P40199(Tbio)
UniProt: P40199
Structure
PDB: 

Position
19q13.2
AA seq 344 aa AA seqDB search
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQ
NRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWV
NGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVP
TISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
AHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggacccccctcagcccctccctgcagattgcatgtcccctggaaggaggtcctgctc
acagcctcacttctaaccttctggaacccacccaccactgccaagctcactattgaatcc
acgccgttcaatgtcgcagaggggaaggaggttcttctactcgcccacaacctgccccag
aatcgtattggttacagctggtacaaaggcgaaagagtggatggcaacagtctaattgta
ggatatgtaataggaactcaacaagctaccccagggcccgcatacagtggtcgagagaca
atataccccaatgcatccctgctgatccagaacgtcacccagaatgacacaggattctat
accctacaagtcataaagtcagatcttgtgaatgaagaagcaaccggacagttccatgta
tacccggagctgcccaagccctccatctccagcaacaactccaaccccgtggaggacaag
gatgctgtggccttcacctgtgaacctgaggttcagaacacaacctacctgtggtgggta
aatggtcagagcctcccggtcagtcccaggctgcagctgtccaatggcaacatgaccctc
actctactcagcgtcaaaaggaacgatgcaggatcctatgaatgtgaaatacagaaccca
gcgagtgccaaccgcagtgacccagtcaccctgaatgtcctctatggcccagatgtcccc
accatttccccctcaaaggccaattaccgtccaggggaaaatctgaacctctcctgccac
gcagcctctaacccacctgcacagtactcttggtttatcaatgggacgttccagcaatcc
acacaagagctctttatccccaacatcactgtgaataatagcggatcctatatgtgccaa
gcccataactcagccactggcctcaataggaccacagtcacgatgatcacagtctctgga
agtgctcctgtcctctcagctgtggccaccgtcggcatcacgattggagtgctggccagg
gtggctctgatatag

DBGET integrated database retrieval system