KEGG   Homo sapiens (human): 4691Help
Entry
4691              CDS       T01001                                 

Gene name
NCL, C23, Nsr1
Definition
(RefSeq) nucleolin
  KO
K11294  nucleolin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4691 (NCL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    4691 (NCL)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4691 (NCL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    4691 (NCL)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     4691 (NCL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_8 RRM_occluded Herpes_BLLF1
Motif
Other DBs
NCBI-GeneID: 4691
NCBI-ProteinID: NP_005372
OMIM: 164035
HGNC: 7667
Ensembl: ENSG00000115053
Vega: OTTHUMG00000153866
Pharos: P19338(Tbio)
UniProt: P19338 B3KM80 A0A024R4A0
Structure
PDB: 

Position
2q37.1
AA seq 710 aa AA seqDB search
MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATS
AKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVA
TPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAA
APASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE
DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG
TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDL
EKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST
WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEAL
NSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI
VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGR
GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctcgcgaaggcaggtaaaaatcaaggtgaccccaagaaaatggctcctcct
ccaaaggaggtagaagaagatagtgaagatgaggaaatgtcagaagatgaagaagatgat
agcagtggagaagaggtcgtcatacctcagaagaaaggcaagaaggctgctgcaacctca
gcaaagaaggtggtcgtttccccaacaaaaaaggttgcagttgccacaccagccaagaaa
gcagctgtcactccaggcaaaaaggcagcagcaacacctgccaagaagacagttacacca
gccaaagcagttaccacacctggcaagaagggagccacaccaggcaaagcattggtagca
actcctggtaagaagggtgctgccatcccagccaagggggcaaagaatggcaagaatgcc
aagaaggaagacagtgatgaagaggaggatgatgacagtgaggaggatgaggaggatgac
gaggacgaggatgaggatgaagatgaaattgaaccagcagcgatgaaagcagcagctgct
gcccctgcctcagaggatgaggacgatgaggatgacgaagatgatgaggatgacgatgac
gatgaggaagatgactctgaagaagaagctatggagactacaccagccaaaggaaagaaa
gctgcaaaagttgttcctgtgaaagccaagaacgtggctgaggatgaagatgaagaagag
gatgatgaggacgaggatgacgacgacgacgaagatgatgaagatgatgatgatgaagat
gatgaggaggaggaagaagaggaggaggaagagcctgtcaaagaagcacctggaaaacga
aagaaggaaatggccaaacagaaagcagctcctgaagccaagaaacagaaagtggaaggc
acagaaccgactacggctttcaatctctttgttggaaacctaaactttaacaaatctgct
cctgaattaaaaactggtatcagcgatgtttttgctaaaaatgatcttgctgttgtggat
gtcagaattggtatgactaggaaatttggttatgtggattttgaatctgctgaagacctg
gagaaagcgttggaactcactggtttgaaagtctttggcaatgaaattaaactagagaaa
ccaaaaggaaaagacagtaagaaagagcgagatgcgagaacacttttggctaaaaatctc
ccttacaaagtcactcaggatgaattgaaagaagtgtttgaagatgctgcggagatcaga
ttagtcagcaaggatgggaaaagtaaagggattgcttatattgaatttaagacagaagct
gatgcagagaaaacctttgaagaaaagcagggaacagagatcgatgggcgatctatttcc
ctgtactatactggagagaaaggtcaaaatcaagactatagaggtggaaagaatagcact
tggagtggtgaatcaaaaactctggttttaagcaacctctcctacagtgcaacagaagaa
actcttcaggaagtatttgagaaagcaacttttatcaaagtaccccagaaccaaaatggc
aaatctaaagggtatgcatttatagagtttgcttcattcgaagacgctaaagaagcttta
aattcctgtaataaaagggaaattgagggcagagcaatcaggctggagttgcaaggaccc
aggggatcacctaatgccagaagccagccatccaaaactctgtttgtcaaaggcctgtct
gaggataccactgaagagacattaaaggagtcatttgacggctccgttcgggcaaggata
gttactgaccgggaaactgggtcctccaaagggtttggttttgtagacttcaacagtgag
gaggatgccaaagctgccaaggaggccatggaagacggtgaaattgatggaaataaagtt
accttggactgggccaaacctaagggtgaaggtggcttcgggggtcgtggtggaggcaga
ggcggctttggaggacgaggtggtggtagaggaggccgaggaggatttggtggcagaggc
cggggaggctttggagggcgaggaggcttccgaggaggcagaggaggaggaggtgaccac
aagccacaaggaaagaagacgaagtttgaatag

DBGET integrated database retrieval system