KEGG   Homo sapiens (human): 4691
Entry
4691              CDS       T01001                                 

Symbol
NCL, C23, Nsr1
Name
(RefSeq) nucleolin
  KO
K11294  nucleolin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4691 (NCL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    4691 (NCL)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4691 (NCL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    4691 (NCL)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     4691 (NCL)
SSDB
Motif
Pfam: RRM_1 RRM_8 Treacle RRM_occluded Herpes_BLLF1
Other DBs
NCBI-GeneID: 4691
NCBI-ProteinID: NP_005372
OMIM: 164035
HGNC: 7667
Ensembl: ENSG00000115053
Vega: OTTHUMG00000153866
Pharos: P19338(Tbio)
UniProt: P19338 B3KM80
Structure
PDB: 
2KRR 2FC8 2FC9

Position
2q37.1
AA seq 710 aa
MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATS
AKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVA
TPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAA
APASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE
DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG
TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDL
EKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST
WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEAL
NSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI
VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGR
GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggtgaagctcgcgaaggcaggtaaaaatcaaggtgaccccaagaaaatggctcctcct
ccaaaggaggtagaagaagatagtgaagatgaggaaatgtcagaagatgaagaagatgat
agcagtggagaagaggtcgtcatacctcagaagaaaggcaagaaggctgctgcaacctca
gcaaagaaggtggtcgtttccccaacaaaaaaggttgcagttgccacaccagccaagaaa
gcagctgtcactccaggcaaaaaggcagcagcaacacctgccaagaagacagttacacca
gccaaagcagttaccacacctggcaagaagggagccacaccaggcaaagcattggtagca
actcctggtaagaagggtgctgccatcccagccaagggggcaaagaatggcaagaatgcc
aagaaggaagacagtgatgaagaggaggatgatgacagtgaggaggatgaggaggatgac
gaggacgaggatgaggatgaagatgaaattgaaccagcagcgatgaaagcagcagctgct
gcccctgcctcagaggatgaggacgatgaggatgacgaagatgatgaggatgacgatgac
gatgaggaagatgactctgaagaagaagctatggagactacaccagccaaaggaaagaaa
gctgcaaaagttgttcctgtgaaagccaagaacgtggctgaggatgaagatgaagaagag
gatgatgaggacgaggatgacgacgacgacgaagatgatgaagatgatgatgatgaagat
gatgaggaggaggaagaagaggaggaggaagagcctgtcaaagaagcacctggaaaacga
aagaaggaaatggccaaacagaaagcagctcctgaagccaagaaacagaaagtggaaggc
acagaaccgactacggctttcaatctctttgttggaaacctaaactttaacaaatctgct
cctgaattaaaaactggtatcagcgatgtttttgctaaaaatgatcttgctgttgtggat
gtcagaattggtatgactaggaaatttggttatgtggattttgaatctgctgaagacctg
gagaaagcgttggaactcactggtttgaaagtctttggcaatgaaattaaactagagaaa
ccaaaaggaaaagacagtaagaaagagcgagatgcgagaacacttttggctaaaaatctc
ccttacaaagtcactcaggatgaattgaaagaagtgtttgaagatgctgcggagatcaga
ttagtcagcaaggatgggaaaagtaaagggattgcttatattgaatttaagacagaagct
gatgcagagaaaacctttgaagaaaagcagggaacagagatcgatgggcgatctatttcc
ctgtactatactggagagaaaggtcaaaatcaagactatagaggtggaaagaatagcact
tggagtggtgaatcaaaaactctggttttaagcaacctctcctacagtgcaacagaagaa
actcttcaggaagtatttgagaaagcaacttttatcaaagtaccccagaaccaaaatggc
aaatctaaagggtatgcatttatagagtttgcttcattcgaagacgctaaagaagcttta
aattcctgtaataaaagggaaattgagggcagagcaatcaggctggagttgcaaggaccc
aggggatcacctaatgccagaagccagccatccaaaactctgtttgtcaaaggcctgtct
gaggataccactgaagagacattaaaggagtcatttgacggctccgttcgggcaaggata
gttactgaccgggaaactgggtcctccaaagggtttggttttgtagacttcaacagtgag
gaggatgccaaagctgccaaggaggccatggaagacggtgaaattgatggaaataaagtt
accttggactgggccaaacctaagggtgaaggtggcttcgggggtcgtggtggaggcaga
ggcggctttggaggacgaggtggtggtagaggaggccgaggaggatttggtggcagaggc
cggggaggctttggagggcgaggaggcttccgaggaggcagaggaggaggaggtgaccac
aagccacaaggaaagaagacgaagtttgaatag

DBGET integrated database retrieval system