KEGG   Homo sapiens (human): 4694Help
Entry
4694              CDS       T01001                                 

Gene name
NDUFA1, CI-MWFE, MC1DN12, MWFE, ZNF183
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00995  Electron transfer in Complex I
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4694 (NDUFA1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4694 (NDUFA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4694 (NDUFA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4694 (NDUFA1)
   05012 Parkinson disease
    4694 (NDUFA1)
   05016 Huntington disease
    4694 (NDUFA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4694 (NDUFA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MWFE
Motif
Other DBs
NCBI-GeneID: 4694
NCBI-ProteinID: NP_004532
OMIM: 300078
HGNC: 7683
Ensembl: ENSG00000125356
Vega: OTTHUMG00000022287
Pharos: O15239(Tclin)
UniProt: O15239 Q6IBB5
Structure
PDB: 

Position
Xq24
AA seq 70 aa AA seqDB search
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY
YVSKGLENID
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgagattctccccggactctccgtcatgggcgtgtgcttgttgattccagga
ctggctactgcgtacatccacaggttcactaacgggggcaaggaaaaaagggttgctcat
tttgggtatcactggagtctgatggaaagagataggcgcatctctggagttgatcgttac
tatgtgtcaaagggtttggagaacattgattaa

DBGET integrated database retrieval system