KEGG   Homo sapiens (human): 4695Help
Entry
4695              CDS       T01001                                 

Gene name
NDUFA2, B8, CD14, CIB8
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4695 (NDUFA2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4695 (NDUFA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4695 (NDUFA2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4695 (NDUFA2)
   05012 Parkinson disease
    4695 (NDUFA2)
   05016 Huntington disease
    4695 (NDUFA2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4695 (NDUFA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 4695
NCBI-ProteinID: NP_002479
OMIM: 602137
HGNC: 7685
Ensembl: ENSG00000131495
Vega: OTTHUMG00000129505
Pharos: O43678(Tclin)
UniProt: O43678
Structure
PDB: 

Position
5q31.3
AA seq 99 aa AA seqDB search
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcagcaagtcgaggagtcggggcaaagctgggcctgcgtgagattcgc
atccacttatgtcagcgctcgcccggcagccagggcgtcagggacttcattgagaaacgc
tacgtggagctgaagaaggcgaatcccgacctacccatcctaatccgcgaatgctccgat
gtgcagcccaagctctgggcccgctacgcatttggccaagagacgaatgtccctttgaac
aacttcagtgctgatcaggtaaccagagccctggagaacgttctaagtggtaaagcctga

DBGET integrated database retrieval system