KEGG   Homo sapiens (human): 4696Help
Entry
4696              CDS       T01001                                 

Gene name
NDUFA3, B9, CI-B9
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A3
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4696 (NDUFA3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4696 (NDUFA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4696 (NDUFA3)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4696 (NDUFA3)
   05012 Parkinson disease
    4696 (NDUFA3)
   05016 Huntington disease
    4696 (NDUFA3)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4696 (NDUFA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADHdh_A3
Motif
Other DBs
NCBI-GeneID: 4696
NCBI-ProteinID: NP_004533
OMIM: 603832
HGNC: 7686
Ensembl: ENSG00000170906
Vega: OTTHUMG00000064972
Pharos: O95167(Tclin)
UniProt: O95167 Q6FGG4
Structure
PDB: 

Position
19q13.42
AA seq 84 aa AA seqDB search
MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD
GNMPDVPSHPQDPQGPSLEWLKKL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagagtcggcgccttcctcaagaatgcctgggacaaggagccagtgctggtc
gtgtccttcgtcgtcgggggcctcgctgtaattctgcccccattgagcccctacttcaag
tactccgtcatgatcaacaaggccacgccctacaactacccagtgcccgtccgtgatgat
gggaacatgcccgacgtgcccagccacccccaggaccctcagggccccagcctggagtgg
ctgaagaaactgtga

DBGET integrated database retrieval system