KEGG   Homo sapiens (human): 4697Help
Entry
4697              CDS       T01001                                 

Gene name
NDUFA4, CI-9k, CI-MLRQ, MLRQ
Definition
(RefSeq) NDUFA4, mitochondrial complex associated
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4697 (NDUFA4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4697 (NDUFA4)
  09159 Environmental adaptation
   04714 Thermogenesis
    4697 (NDUFA4)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4697 (NDUFA4)
   05012 Parkinson disease
    4697 (NDUFA4)
   05016 Huntington disease
    4697 (NDUFA4)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4697 (NDUFA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B12D
Motif
Other DBs
NCBI-GeneID: 4697
NCBI-ProteinID: NP_002480
OMIM: 603833
HGNC: 7687
Ensembl: ENSG00000189043
Vega: OTTHUMG00000023880
Pharos: O00483(Tclin)
UniProt: O00483 A0A024R9Z0
Position
7p21.3
AA seq 81 aa AA seqDB search
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND
QYKFYSVNVDYSKLKKERPDF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgctccgccagatcatcggtcaggccaagaagcatccgagcttgatccccctctttgta
tttattggaactggagctactggagcaacactgtatctcttgcgtctggcattgttcaat
ccagatgtttgttgggacagaaataacccagagccctggaacaaactgggtcccaatgat
caatacaagttctactcagtgaatgtggattacagcaagctgaagaaggaacgtccagat
ttctaa

DBGET integrated database retrieval system