KEGG   Homo sapiens (human): 4698Help
Entry
4698              CDS       T01001                                 

Gene name
NDUFA5, B13, CI-13KD-B, CI-13kB, NUFM, UQOR13
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4698 (NDUFA5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4698 (NDUFA5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4698 (NDUFA5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4698 (NDUFA5)
   05012 Parkinson disease
    4698 (NDUFA5)
   05016 Huntington disease
    4698 (NDUFA5)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4698 (NDUFA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETC_C1_NDUFA5 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 4698
NCBI-ProteinID: NP_001269349
OMIM: 601677
HGNC: 7688
Ensembl: ENSG00000128609
Vega: OTTHUMG00000157348
Pharos: Q16718(Tclin)
UniProt: Q16718
Structure
PDB: 

Position
7q31.32
AA seq 116 aa AA seqDB search
MPYRVGQTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK
AEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgccttaccgggtagggcagaccactggccttgtgggattggctgtgtgcaatactcct
cacgagaggctaagaatattgtacacaaagattcttgatgttcttgaggaaatccctaaa
aatgcagcatatagaaagtatacagaacagattacaaatgagaagctggctatggttaaa
gcggaaccagatgttaaaaaattagaagaccaacttcaaggcggtcaattagaagaggtg
attcttcaggctgaacatgaactaaatctggcaagaaaaatgagggaatggaaactatgg
gagccattagtggaagagcctcctgccgatcagtggaaatggccaatataa

DBGET integrated database retrieval system